SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|194601|estExt_Genewise1Plus.C_130130 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|194601|estExt_Genewise1Plus.C_130130
Domain Number 1 Region: 418-516
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.59e-16
Family Mannose 6-phosphate receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 224-277
Classification Level Classification E-value
Superfamily EF-hand 0.00000107
Family Calmodulin-like 0.045
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|194601|estExt_Genewise1Plus.C_130130
Domain Number - Region: 49-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000668
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number - Region: 85-124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00223
Family LDL receptor-like module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|194601|estExt_Genewise1Plus.C_130130
Sequence length 533
Sequence
MFHKEFRAIIFQNVLILCASAVLWKQTTVAATQVTRPRGVSLARASLYSPDADFTCLDGS
ATFPFRYVNDDYCDCQDGSDEPGTSACPNGSFYCRNLGHEAMIVPSSRVNDGICDCCDAA
DEYQSGANCVNTCKELGSAAQEEAQRRYELESQGYAIKLEYINKGRQAKLSQQERNMALK
AEQVEAEALRAEKEREKHEAEEPERQALDKYRQIEQEAVKEKEEIERSKQETEASKAFDW
LDSNQDGKLQVEELQTHVAFDQNQDGTVTVEEAKFFLHNEEEMEKSDFIATGWPLIKPFV
MKAQGLENPSQPDQQTGEIPLPDDHQQDESMPETEGEEEEDEEHEEEAEPVKPSPVTPNS
VEYDAETQELIEVANKARNSYDEADRRLRDLEREIRQLEESNSKDYGPNEEYQPMDGQCY
EYSDREYTYKLCPFDNGSQRPKHGGSETRLGSWDSWDGPAENKYGAMKYDKGVQCWNGPQ
RSLKVHLSCGMENQLLSVSEPNRCEYEMKFTTPAACGEPKKPDDGDSEIHDEL
Download sequence
Identical sequences E9G8J3
jgi|Dappu1|194601|estExt_Genewise1Plus.C_130130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]