SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|194610|estExt_Genewise1Plus.C_130142 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|194610|estExt_Genewise1Plus.C_130142
Domain Number 1 Region: 17-267,335-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.2e-85
Family Type II chitinase 0.00000198
Further Details:      
 
Domain Number 2 Region: 261-337
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000058
Family Chitinase insertion domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|194610|estExt_Genewise1Plus.C_130142
Sequence length 482
Sequence
MKIVWALAVLSCCAIPSVVGTRFVCYFPNWTYSRGGDGKFGVDNIDPFLCTDLVYSFAVL
DGATYQIKIADEWGDIGNNGYANFIALKTRNSQLKTTIAIGGWNDSHDGTNKYSSMVASP
ANRKIFVDSVVAFFELNKFDGLDLDWEYPSGESDKAGFAELLKELRLALGTKLISVAVAA
NSTIIDLGIRYDIPVLAETADYINIMAYDMHGPWEPLTDHHAPLYKREWDTDATNNIDAV
VKYWKDSGMPSSKLMLGIPLYGKSWTLDYTYTENPTLPAPGLGNGAAGPLTSLPGTLGYN
EICNYVKNENWAVVVDPEFKIGPYASTPSVPKTWVGYDDPVMANVKSRYVLDRGLGGAMV
WDMSTDDFRNTCGDGPNPIMTNISRTVGVTTSTTTTTPAVTTKTTTASTSTTTGETTTTT
PTTPRASTTKLSTWPRVTTERTATQATSSKTPFIPNDGHRIAGNSQQLTFLAFGFILINF
VI
Download sequence
Identical sequences E9G8K5
jgi|Dappu1|194610|estExt_Genewise1Plus.C_130142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]