SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|194717|estExt_Genewise1Plus.C_130353 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|194717|estExt_Genewise1Plus.C_130353
Domain Number 1 Region: 253-275
Classification Level Classification E-value
Superfamily DPY module 0.0000693
Family DPY module 0.0029
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|194717|estExt_Genewise1Plus.C_130353
Domain Number - Region: 195-218
Classification Level Classification E-value
Superfamily DPY module 0.000432
Family DPY module 0.003
Further Details:      
 
Domain Number - Region: 361-382
Classification Level Classification E-value
Superfamily DPY module 0.00248
Family DPY module 0.0035
Further Details:      
 
Domain Number - Region: 6-146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00361
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number - Region: 315-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00706
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 156-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0191
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|194717|estExt_Genewise1Plus.C_130353
Sequence length 429
Sequence
MVSPLGVAVCRCKSGYFPKPDTITGCGHQCDDDDDCSNSQNCANGRCVNICEEGICGVNA
LCEPRNRRAICRCPSGYSGDPFTRCSAGQTENTECPSDKVCHNFRCINPCSTSCGVDSEC
TVRNHVTVCQCPKGFTGDPFVSCTPSSSSNVAGRQSSDYCTPSPCGTNTKCRVENNRAVC
SCQDGFMGNPIQGCRRECETDFECDANRACMNFRCQDPCGTCGTYADCNVRNHRAICSCP
ANFLGDPFTRCYPECTQHEECRATQACFNLKCVDPCTGACGIGAECRVESHKAICSCPKG
HTGHPFDRCRPFDKSDLCNPNPCGTDADCKPGTDRQGNDRPVCFCRTGYLGDPLVGCRKG
QCIDHADCSGNQACYGYQCVDPCTSTSSSRSSVCGIGARCDARNHGAVCSCPVGQDGDPL
VECRASFRG
Download sequence
Identical sequences E9G914
jgi|Dappu1|194717|estExt_Genewise1Plus.C_130353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]