SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|196945|estExt_Genewise1Plus.C_250265 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|196945|estExt_Genewise1Plus.C_250265
Domain Number 1 Region: 13-596
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 5.77e-161
Family Myeloperoxidase-like 0.0000000696
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|196945|estExt_Genewise1Plus.C_250265
Domain Number - Region: 612-658
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00902
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|196945|estExt_Genewise1Plus.C_250265
Sequence length 680
Sequence
MCPIHPDCDHKTFNSPFRTITGICNNIHPPGHVPWGLPKTQYQRALAPNYADGVWMPRRA
KNGGQLPLPRLLSLLLIRDLDVPSDTDTTFVMQYGQFVDPNGSAVPCCTEDGEFLEENDL
SHGKCIPIEIPKDDPFYAKFRQRCMQFARSAPACRTDGRLGHVEQVSRMNQNTHFLDLSG
LYGSDDQVAGELRTFEKGALKVFARKGYHQHDMDLHPPDNDTDVDCALSKAIDLTLTIFI
FDACTNTGDNRVNVSPYMVASQTVFLREHNGVAELLMELNPHWGDERLYQEARRILIAQM
QHITYNEFLPILIGRDKMQELGLLPLQHGFSRDYDETVNPSVLNEFAAAAFRFGHSLVPG
KQDLINQRRVKERDILLRQHFFKTTETYTPGNLDKFLIALATVPGQRVDTYFTEEMTNHL
FEEEGKGFGMDIVSLNIQRGRDHGLPGYNSYRELCGLSRARDFRDFLDVIPPRIVEKFES
MYNSVDDVDLFIAGVSERPTKGAMIGPTFQCIIADQFLRLKRGDRYFYDLGGQSGSFTEE
QLDEIRKTSYSRIVCDNSFVQFIQPLFFKAESELNPIVSCESFDSIPRMNLYPWKEIENS
DWQIAEDGVKWAQNCDFEGHDIDAPLNLIDGGQCGRICIDTPGCNAFWSKGGSCSIKSIP
EGFRRTHFIGGVCGIIPWKF
Download sequence
Identical sequences E9GJE0
jgi|Dappu1|196945|estExt_Genewise1Plus.C_250265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]