SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|204203|estExt_Genewise1Plus.C_1980013 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|204203|estExt_Genewise1Plus.C_1980013
Domain Number 1 Region: 31-229
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.97e-55
Family Astacin 0.0000711
Further Details:      
 
Domain Number 2 Region: 349-458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-38
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 3 Region: 667-775
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-36
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 4 Region: 504-616
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-34
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 226-350
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 6 Region: 772-891
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-27
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 7 Region: 457-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000238
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 616-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000239
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|204203|estExt_Genewise1Plus.C_1980013
Sequence length 909
Sequence
MTKAKKNKRKDRIRQITEKPTALIRSRRAATARKERIWDFGVIPYEIDANFSGAHKALFK
QAMRHWENFTCVKFVERTADHPHFIVFTERACGCCSFVGKRGNGAQAISIGKNCDKFGIV
VHELGHVVGFWHEHTRPDRDNHVHIIRENIMAGQEYNFNKLTSEEVNSLGLSYDFDSIMH
YARNTFSKGTYLDTILPQADPETKSRPEIGQRIRLSEGDISQTNKLYKCPKCGRTFQENK
ASFTSPVFPPGTVSEDGERCEWRITATHGERIVLNITELDVFKGDNCKYDYVEIRDGYWH
KSPLLGRFCGSTRLPDPVMSSGSRMLVTFQSSPRQIGYKGFSASYEALCGGDLNVDSGHL
ESPNFPDDYQPNKECTWKITVPSDYQVALKFQSFEIENHDNCVYDFLEIRDGHEPTSPLI
GVYCGYNIPEDIKSSSNKMWIKFVSDNSVQKAGFSAIFMNEFDECASLDHGCEHSCVNTL
GGYECQCRIGFELHSDGKRCEDACGGLIDSPNGTIISPSFPDLYPSNKHCIWEIFAPPQY
RITLNFTHFDLEGNNQDCEYDHVEVRSKLSENELRKHGVFCGTHLPPVVTSEGNVLRIEF
ASDNSVQKTGFAAVYFTDKDECAVNNGGCQQECRNTIGSYVCACNNGFTLHENGHDCKEG
GCKHEIRAPYGEVLSPNYPHPYPARKECVWHFTTTPGHRIKLVFHEFEIESHHECAYDHV
ALFDGDSSEDTTLGRFCGLKAPPPIAASGNELYMVFKSDASVQRKGFQATHATVCGGHLQ
ATTGVKHFYSHAKYGDHNYENKEDCDWIIEAPAGKNVHLTFLTFELEDEHECGYDSIEVF
QGFDDSGPTNGRYCGNRVPPEIVSLNEALLVRFKSDDTINSKGFSAAYVAIDENENEDLP
KSQQSVRYN
Download sequence
Identical sequences E9HQF5
jgi|Dappu1|204203|estExt_Genewise1Plus.C_1980013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]