SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|207420|estExt_Genewise1.C_50350 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|207420|estExt_Genewise1.C_50350
Domain Number 1 Region: 460-1000
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.39e-130
Family alpha-mannosidase, C-terminal domain 0.0000000151
Further Details:      
 
Domain Number 2 Region: 33-364
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.26e-116
Family alpha-mannosidase 0.00000000871
Further Details:      
 
Domain Number 3 Region: 365-460
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 3.92e-27
Family alpha-mannosidase, domain 2 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|207420|estExt_Genewise1.C_50350
Sequence length 1003
Sequence
MKLPFIGIFSLLAFGCCWITTDAAPQQRASSCGYDSCTPSKPGVINVHVVPHTHDDVGWL
KTVDQYYYGSKTGYQRAGVQYIIDSVIKELVKDPARRFIYVEMAFFSQWWQEQTEEKKAV
VKQLVEEGRLEFINGGWCMNDEAGTHYNDIIDQMTWGLRFLNDTFGECGRPKIGWQIDPF
GHSREQASIFASMGFDGVFFGRIDWVDRTQRKAKKEMEMIWHTSNSPGEPNSIFTGIFYE
HYSAPNGFCFDVVCRDEPFIDSPRSADYNVVKKVKDLEAHIKAKALSYSTSNIMLTMGDD
FNYMSADMNFKNMDKMIRYTNELASGVNLFYSTPSCYVKAINDEAGSRPWPTKTDDFFPY
SNDPHAYWTGYFTSRPAYKGTVRKANTFLQSCKQLHSLAGPSAGGQNLIDSLRRSMGEAQ
HHDAVAGTEKEHVSQDYRLRLHDSLVDCQKDVGNSFSQLLPIGSQALPPQEFCLHLNVSQ
CAITESSSRFVATVYNPRSHQVTTYVRLPVMNGVYTVLDPDGSELIVQLVPLVNLRSIET
ERPKSSATHELIFQAASIPALGHKTFYILKSSARHGQQHSTTITSRERQSTTKLTVNFDA
NGLIESVVVDGVTVMMSQNLMWYAGMNEGNANSIFDDRPSGAYVFRPNGTDATPISTQAT
LIVQTGALVSEVYQQFSDWASQVVRVYKGQSDVEIEWTVGPIPVGDGIGKEIVSRVTTQI
PSGGRYYTDSNGRQTLLRRRDFRPTWTLDVTEPVSGNYYPINSHIYVTDSEQNAGAVVAL
VNDRSQGGTSLKDGQIELMVHRRLLYDDHFGVGEPLNEPGDGPGLVVRGTHYLLVNPSLA
GNHPVSLIRPLAQQMFMRPWMSFSATSLSFTNWKNNFRTEKSGLRAPLPDNVHILTLEPW
RDGTHLLRLEHVYDIGEHSTLSEPVTLILDDLLADYTITSAVETTLGANQWASESSRLPW
TTANHQQPLKKVSSKTRQSSSGKTSVTLLPMEIRTFIIQMTPK
Download sequence
Identical sequences E9FYS4
jgi|Dappu1|207420|estExt_Genewise1.C_50350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]