SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|209471|estExt_Genewise1.C_120163 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|209471|estExt_Genewise1.C_120163
Domain Number 1 Region: 127-428
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.97e-38
Family NodB-like polysaccharide deacetylase 0.0085
Further Details:      
 
Domain Number 2 Region: 20-65
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000392
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 75-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|209471|estExt_Genewise1.C_120163
Sequence length 490
Sequence
MNNGKFYRNPDREKAKMWSTGECAKYYLCIENEVFEFKCSTGLLFDIVRQICDFKAKVDN
CDVNTEAALPKPLLNTPEPICPVNELACADGTCLNSDLFCDGHADCVDGSDEGWCDADND
PNAAGRCDYANCTLPNCFCSVDGTLIPGNLEANQVPQMVTITFDDAVNGENWDLYLNKLF
IPERKNPNGCPIHATFYISHEYNNYQHVQKLWNAGHEIAAHSITHRQPENWWSTNATIED
WFDEMVGQANIINRFAGVHMEDIRGIRVPFLRVGWNRQFLMMKEFGFVYDASMAAPLSDP
PLWPYTLDYKMPHGCVGTGQRCPSRSFPGIWEMVLNQLEVEEYSCAMVDSCPSHGSEDEV
YEMLMHNFKRHYNTNRAPFGLYFHTIWFKKRINLRAFQRFLEEMIRMPDVWVVNNWEAIQ
WMQRPTPINALSQFDPWKCKPTVPPEDKACNIGRACKLQSRALRGDRYLHTCTECPQVYP
WIKNEFGLDI
Download sequence
Identical sequences E9G751
jgi|Dappu1|209471|estExt_Genewise1.C_120163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]