SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|213162|estExt_Genewise1.C_360210 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|213162|estExt_Genewise1.C_360210
Domain Number 1 Region: 2-210
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.37e-60
Family Papain-like 0.0000189
Further Details:      
 
Domain Number 2 Region: 217-277
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000241
Family Tachycitin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|213162|estExt_Genewise1.C_360210
Sequence length 278
Sequence
MDYRNDPCMPPVRNQGGCGSCWAYTASAVVEFGKCKKSGGNAIDLSEQQIVDCSLGSGCS
GGWEHEAWKYLASCGGHALESSYPYAGRDGACRFSPTGMTIGAKLLTSIPVEWVPSKDTS
TMMNILSDGRILTVYIHLPDSFFNYKSGIFDDTKCNSGSAHALNPVGYGTLNGVDYWVMR
NSWGAGWGSSGYVLVKRGIDLCLIESYARTTNIDTTTTTSLENFCTNRPNGNYANPNECQ
SYISCSNGSAYKMNCPSGLAFNEKYNSCDYIYNVPGCN
Download sequence
Identical sequences E9GQ66
jgi|Dappu1|213162|estExt_Genewise1.C_360210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]