SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|214208|estExt_Genewise1.C_510044 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|214208|estExt_Genewise1.C_510044
Domain Number 1 Region: 79-159
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000000000000235
Family Pan module (APPLE domain) 0.021
Further Details:      
 
Domain Number 2 Region: 165-228
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000116
Family Hairpin loop containing domain 0.058
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|214208|estExt_Genewise1.C_510044
Domain Number - Region: 11-45
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00353
Family Pan module (APPLE domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|214208|estExt_Genewise1.C_510044
Sequence length 647
Sequence
MLDSQPGTLMLTDCIQTCRQNTSCQSINYETGLCVLFSSNADAMPGALTTSQFPVFTLYV
QKNCLRITVGANTVCNRAWSFERVQGYELETLAKRRRRVANRQACEELCLGEREFTCRSV
NFNNVTGDCRLSDMDRHTMAGTGAFKPSSSSDYMENNCVDDPVKLCEFQKLEGRILKTVD
SVFQDVSTIDDCRQLCLTAPYRCHSFDYADTGENVCRLSHHALATLTNIQEPYLEIAGAA
TYELSSCYNVTIDCRSGDMVAKIRTSKIFNGKIYAKGSPNSCVNDVTASLDFELRMAYND
IECNVRKDGQGRYSNDIILQHHDRIITSADLGLSVHCQYDLGNKSVSNQVDLEITGDIIP
VLSEEAVVEGPNVVMRVTTKDGVDVPSAQVGDSLDLRFEIVDKNSPYEIFVRDLVALDGV
DSNEILLIDDRGCPTDPSIMGVIDKSAESSKILLSAFDAFKFPSSDKVQFRALVSPCLPS
CEPVKCDVADYTGDVRLLDSYGRKRRALSRERRDANSEEVLVVQTIEIVDRFNPPPAADL
SDSVMELEKERNHYSFINDFKHGGNSSLTEVFIKEKLSGSSCINTLGLIIAGALFLAAQL
VIIVAWTYIWQRKRRAKQQDNMTMVDVAVNNLHQLYNPSNAGYSRRL
Download sequence
Identical sequences E9GXM8
jgi|Dappu1|214208|estExt_Genewise1.C_510044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]