SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|218190|estExt_Genewise1.C_1290056 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|218190|estExt_Genewise1.C_1290056
Domain Number 1 Region: 30-319
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.5e-26
Family NodB-like polysaccharide deacetylase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|218190|estExt_Genewise1.C_1290056
Sequence length 373
Sequence
MQRILAIIFFLAIFFHQSQAQCNSTNCVGPACRCMSTSSPGGLTKAQTPQLVFLAFDGAI
TTTNYDNYTYLLNNRINPNGCPIGMTFFIFHEYNDYSLTHSLYFKRQEIATHSMSHLTPA
ETWRNKSVAEWTNEIGGIKDALAKFANIPKAEIRGARAPFLQSSGDATCTAMKNLGMFYD
CSFPTTENTNPPIWPYTLDQGFQHECAIPPCPKNKYTGVWTVPMVALNRNGTICSMADAC
DKPNTLDETYQYLMDNFQRHYTTSKAPFGIYLTANAWFQSAEYRLQGYKKFLDTLSTKDD
VYIVPIARGLDWMKNPKPLAEVGNFFTCPAMTQTTCSNFSCYYEGDASPVGPRNMKSCVT
CPDVYPWTGNPLG
Download sequence
Identical sequences E9HI03
jgi|Dappu1|218190|estExt_Genewise1.C_1290056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]