SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|220428|estExt_fgenesh1_pg.C_20230 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|220428|estExt_fgenesh1_pg.C_20230
Domain Number 1 Region: 264-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000339
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 2 Region: 192-227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000429
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|220428|estExt_fgenesh1_pg.C_20230
Sequence length 313
Sequence
MAEMMTKEEQDRMDDVQSAGANPTLSMMTASDEDPVSRGKNNNKKKDGGGKGNKKEDKKN
KTEKKEATKEPKNKAEGKASKTPPASSSTNAPAEKKNKGKKGNGDNKHASGKGSSAASSE
ARNVNEVESTDGAEESGPNSPVDFATLDQSCLVDADNNNSPVVQAPAIPHGSGIKYIRKR
NKGPGGGNRYAAAVFQCAAGYQFVVPDADRLYCRQGRWIGPSPICIIPDTDQTDQGAGAV
SNNALTEREEESANAGSYGYGTGRSECGEDKGGCEQICDDTSGRATCLCYRGYVVDQDGV
SCTGSLTRFFQTS
Download sequence
Identical sequences E9FT13
jgi|Dappu1|220428|estExt_fgenesh1_pg.C_20230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]