SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|220648|estExt_fgenesh1_pg.C_20642 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|220648|estExt_fgenesh1_pg.C_20642
Domain Number 1 Region: 2-277
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.95e-104
Family Protein prenyltransferases 0.00000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|220648|estExt_fgenesh1_pg.C_20642
Sequence length 286
Sequence
MNGIYWSLTAMDLMGKLGEMDRDGIILFIKQCQHENGGIGASVDHDPHLLYTLSAVQILC
LYDALDAIDCEKIVNYVKKLQNDDGSFCGDQWGEVDTRFSMCAVACLALLGRLDAINIDN
AVNFVISCMNFDGGFGCRPGSESHSGQVYCCVGMLSITGHLHLIKADSLGWWLCERQLPS
GGLNGRPEKLPDVCYSWWVVASLRIIGRVDWLDKNQLRKFIMACQDVETGGFSDRPNDMP
DPFHTLFGLAGLSLLGESSLKTINPVFCMPQQVISRLKIQPQMLSL
Download sequence
Identical sequences E9FU55
jgi|Dappu1|220648|estExt_fgenesh1_pg.C_20642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]