SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|220785|estExt_fgenesh1_pg.C_30200 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|220785|estExt_fgenesh1_pg.C_30200
Domain Number 1 Region: 144-262
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000297
Family C-type lectin domain 0.0062
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|220785|estExt_fgenesh1_pg.C_30200
Domain Number - Region: 39-119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00576
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|220785|estExt_fgenesh1_pg.C_30200
Sequence length 263
Sequence
MNNQQFGFLVFICSAFIASVSALNACGGKVFVEDEVVIDAPTDADCVWQIETETDRILAI
SAVRDENLQQLLTIRDGLVEGSPILLAEEQQEIVYTTQSTAEIRLQKMPKTSASHFQLKI
QKAVVCPTDLGLESNCTRLIDDVSCHCASFTKRNQTDQVAFCDDNGMLLVSIETPEEDQA
ISDTWGLGSDFWTSCVKNFGRWVWEATGKNLYPGYVNWYPIAEPFCNDQWDANYTCMLIG
YNGLHWASYHCDGVWGAVCELHP
Download sequence
Identical sequences E9FVR5
jgi|Dappu1|220785|estExt_fgenesh1_pg.C_30200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]