SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|220978|estExt_fgenesh1_pg.C_30498 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|220978|estExt_fgenesh1_pg.C_30498
Domain Number 1 Region: 162-223
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 5.49e-18
Family Tachycitin 0.0029
Further Details:      
 
Domain Number 2 Region: 102-159
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000136
Family Tachycitin 0.033
Further Details:      
 
Domain Number 3 Region: 40-99
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000575
Family Tachycitin 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|220978|estExt_fgenesh1_pg.C_30498
Sequence length 229
Sequence
MKSTLVLLLALYGFLALFATAVTSSRLRADERDIDLGESDYQCPEGLYVAPHETQCELYY
ICASGGTPTHLYQCRDDLLFDLKYYGCNFKDQTECGDRLAPFTCPSPSGQFPIREGTCDS
RYYVCTNDVAKLQVCPNGGIFDAASSACVATACPTTTTPAVPTAPGLFECPAPSGNFPSP
YSCSQYYVCVDGTALLFECAAGLYYNAPLDICDWPSNVNCNLPTSSVNI
Download sequence
Identical sequences E9FUK9
jgi|Dappu1|220978|estExt_fgenesh1_pg.C_30498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]