SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|220982|estExt_fgenesh1_pg.C_30506 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|220982|estExt_fgenesh1_pg.C_30506
Domain Number - Region: 82-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000255
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 4706-4785
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 4593-4691
Classification Level Classification E-value
Superfamily SEA domain 0.0196
Family SEA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|220982|estExt_fgenesh1_pg.C_30506
Sequence length 5035
Sequence
MVRDETECQCNLKMTTRIKSRRQKEREKISSSFMAIMCLLRLPQEREEREREKNKICTQA
MGRPSFAHKTQRKKKRNRDDGHCQPWEFTCLCGQPRCISGDLVGNGNLDCADGSDEGLIG
GNCKSDEDLQNIDDLVRYRRASSDVRVEVNAGQTTTFFLKTELPLNRPRPLGIITSTKGA
FINEGTTTEYTTQIVGTLVDGTYAKIQSTKSRVFSPVPTDLFAVDLPADLLPTGLVSSSL
VTRIRGETTTIETTEFVRTFIDAIYVQEILTSSEIFAPLKPLDDQSTNVQPSPVSQIVIP
TVVIDSSLANEDDSGKIIFKTAHLTSLVGERVIESSIGGINPAFDEDKPTDDESKKIITS
FEEVPDNNLRGSRARSDLSPELVVQTKPVVVLETFVANLPSARIAQPSAIEPEISESDVP
VTEETESTTINLLSDEPEPVLPVEIETAVKDPAIKIETVVPAPIVIAETVQSEPTPAVVP
VKIETVAESEPVVPVKIEVKEVPAVQIVAVESGSVPVVKTNTPAPAVIAPFHVDAVISDA
AVEDIEFEPEAFTVVPESETEANTESEVPSQDGQREPRVEARPPAIRPAIPVLATLQLRP
TEPSRPVGLISSFEGSLVNNGVTTVYTSLIFGTVIDGEWANVVSTITSVITPSAVLPVQV
TPVSAAPAPIVPVKAPVEIVATAPVAVAVTELPVESKSVAPVELESSLSQPVEASTPVAE
TPQGLLPVTRVTTFTFFTTFTETKGEEVITSVSSREVVSSDVQFVEETIKPDDIIEMMLG
ESGNETSPSITTVFKTYTYFSTLFDESTTKMITREEVESSVITLTGDSPVAATPKFQEAT
TMMEPEMMSTKLVDEIQPSVIESSLMESVGDAEGKRKQLFSSLAGGIVKTFFTTFTFFTT
ALINGTTVVSSRIVVSTNAVTPTVQLTDIDEELWESLKAQDERRSQESALASIPASVSEP
VLEPTLTAVAGPTIETVVPVVFTSTPVVWMPEPTTLAVEPVSEEPEISLPEVTVETSEEP
IISTDLPTPPSVEEPVPVVPIEIPMEPTPVMVSSESPMEIISEEPAVIVSESPDVATIEP
STETDPSLPQTLYTTFTYLTTFFTEGTSNVVSREETVTNVITETDVVVEATVPVFPITYY
TTFTYKTTSFSEGQTLIDTREETVTNIVTPTAAEPSPASVEPIVATSVVEIVPTPAIDPA
LTTFYTTFTYFATSFEADLPVVTSSVETITNYVSASETVMPPFVKPPAGVPDEALVIDIQ
PTPPATAGDSVANNTARNIGTNGVSQLIIDLAESEKTSLPSLTGLLSTIRSTLVNNGITT
VFTTDVLGTFINGQYARILESSSEVLNPAVQIPATVIVAASGVEGLEATDLFPTSVSTPA
VELEGSIVLPVSPSQTTISPTPAAESGVEEQDNEGSKVDGGRITTRLSAPPRNRTFVPSI
RPFTQRPRPPLPIRPRRPPFTSAVASVAGDETSSTPSIAPSPASISGSSSSSSSTSTSAG
SISRPAPFSSRFRPSGASSIAVASSTSTESSSRSGSQFFRLRSSLSGSPSSSGGISPTPV
LTPSSTGLPGRRFSSSSFVPSIGSARSSIGGLPPRRPSILSSGVRPAGLSSSTIASVSSP
ASTTTPRFARPTTPPTVAAIEEEITTDDNVEAVSPTTARTASSSFRRPAPIRPASPAIEP
SLVSPLIPSRRQFPFSRANSRNVNPAVTVTESTRAPSDSGSSINAVASESGATSRPRFVR
PPKLTFTEKPRPAVTRPTRPANRGEAAAAVAASNVNVVTVEAPETVNSRSKRQIDFDHYF
YDPAHYRRPSRKTNRTRSRTTTATALNQDYDYEQRIALLDAVDYDGLDYDDRKVTKSRQT
SSATSALRDRLMANRQNRNQNTTPAPRTRTRTSASSTGRTQSRRPGTSSATRSRPSTNAA
TRQRARTSTTTERPSGGRRTFGNNARRPGTRNRVPANDFEEEEFISPEPVLPSSAPSLSL
PISVTHKIPTETTIPVVNNGRTEFRTVIAAKPSIEVLDQYSTMRVSGTWRYLASEVSATP
TPGTTLITQYVLKPTETTTVTFTPTTIRGRPTSFSHIVPSTAFEVETVVSTISDPLASTN
NLLQQLLLGGLQQSGPVTSFITHTNTFVTTLTELKTTKIPITLRGQEIFTTIIGSLSSVI
TATDFSTETIITGPTEGPGNPLANLLPALLGNQLLQAQLLAPQLQPAQVMPIQATQVPQA
AVAPQQPKKEEVFSSQVFDDQFEEVVFEPLEEVKAVFEQPREEIIPAKPIPVTSVITLFL
SGRRPGEFSSILSTITLDGADATVVKRQIDPTDILPMEASELPFMVGTDKGIYELPEKYS
PLDLDYYVMSAINEMDTEAIEDAKETQRLADIVKKAKGSSKRKARQVSFDWTEEEPLEAI
ESNLEEFRVEPLPSGRGTLRRRTVTRKVSDLLPVSERKIGEDFVSNNRARKVVVVTRRRP
VSPTNAVDEQTIARRIDKEEPANADGKPFVVIRKRPVNREEPKSEAPPLSSSLIEPETES
PLRNNLFGDAYAPRTYFTVYSYFYTLLNGPNSGQVSTREVSISEVVRGSDGRIPAGFQRT
ENGNGLYPLSSGRSVADLSTRINNGITTQVNLASITLVKYGRGAVRASAIGLKPKEETPV
RPTTQPPRRVSIVPTPRVEPSFDDFASDLNNDVTVLPTQKLPSAVTRTRGRALDAARTTN
VVRQPVAVEEVKTISRAPGSNRGRGTIRFNPASVLGESVDVLPTLTRPRVNVEQRVPQQQ
QQPRIIAPPTRGPVRVPSRVLPARVPVRSSVVREPIRRPEPVVRNSIIRGRPRPIQEQDL
FVDVPEEEPLPPFEDEVFYDDLGFTEDPPADEDYFYDNHEGGLIDGQEPEYDDFVDTNEP
PLVELNTVETATPAVKTRTTVASTPVVSATATESTTTSISKLIGVTPVRRTTISRKLLNP
LQSHLSSILANSRSGLRSSSSVLKTNEPGSSIPFRLRSHSKSSVVPTFTTSTVVWEQFQT
LSTLAVDGGRSGIPLTLITSSLTTLYDSELSLLTASPDVFKPVVQPTVLPMSRNKPHNFN
PTARLTLPIRASVAIGLLPSTGIVESTIEDTSEPTTESNIDTTDVPFLSDLLNRGGNIVT
VVETHLKTFTAVITRKSGNEEEVTTRLEVLPELVTKTVVQIEPTSVVDVQASLDALENLV
PTARAIPARDGREQLISDDGIEEVRGARLNVGSGSSNRNPNFATKIMSNGVEVLVANEKK
PTLLAQNVVQKSQTVIEPSPPITLAASTLINQVTLAGEVENVRLFSSIQSDPARFQTLTQ
MTTFTYLTTLFDGASKLVSSREEIITNFVTQEKGRKETVVKPTATVTTGQPGSSNYNTFT
HMTTYTYFNTFVDQKRPVVLTSKETVSNVITVPAGQPEASEPSFETATYLRTYIFSSKLD
RDAIATSKEVVTQVVVTEAPRLKVQPTPVATFMEVTKTYLNTLTLLSTQIDGTTSTVHRV
TTVRPEIVVETIRDFEPTPVLDGSLIMPTEDDFGGDGPLVATKTYFTTKTHFTTLQQGTK
TIVQSRKEVRSSVVTETIDGNRASLFAQPASVAKARPTYVQLGPNLYGKLRTLFATATYF
ITNSAGEISSKRLVVPQVSTEMVPLDSIPSEALIEPSIPVLSDIEVTEVPTGSSQILTPE
QLQSLKLSFLAGQQSSAANVQPSLILSPEHLSSLKESFLSNQPSVTPTDSPFETIDTSTD
PELTDFTTDPSIDDGFEPPVISLSPPEVGAGETVIMVTNTAGEVLIIPTEILGNQPSVTS
SSSSSSSGIIGGLSGGTLASILGGLGTIGLTALGQSFANNNPGGLNINLGPMFDAMTGVL
SNGLIASRRNSTDRSDTSAPSHLTSFNQQQHPSNTFPPSNPRVTLREPLFIPIGGLAGVE
TLQQNPDVQGRRPPNIIPLRPGQQLPQQLTPNRPQRPPTVLRRPEPGVPLQPGVPGSPLL
RPGASIGQQFGVGQPAQQLVAAPISFSAPPLQTGFTGMPNQPKSVLPSTRTSGLATAVPG
VRPPPPPFVNGQNNIDRAHIEPSRPIQTPIRPANGQFFAANGQQINVPPLPGSVIPPPPA
SPPPAPPGPIPQPPVDVIGPGSIVPGPDGKPVRIVGVPEGEEPPPGAVGQVFIRPVPAVV
PVFPSVVRPEQQLPPRREDVIVPQPGTRPPPIQIPAVQTIASIVGDNKIVATNIINGGQT
TVLLPNDPTPVFNVPSVSVTIDVQPSNVEGFSVMPTEVSESGANLEGVSSILQPGLSPTT
PASNLEGVGSMLQPGLAPSASPEGGNIEGIGSLLQPGLVPSGAASLPPAMEISSTSVTPS
LHEFAFGSESGEVDHTPTLNIFSDSPSTEIMPSVFQNAPSEAPTSEPKWPLVHHDMDSLE
KKEPFGVTSVVMGPDSQEFTTFVSRVESDGRTAFSTIIQKSTAVAYVEPTTMPTTTAAPV
TPDIEEEEEKIAEPVLTFPPNSPFVPPTNPPMRPQAISSSSSTSTTKSRTTSTTPAAEIE
PPMAKDVIMDNTGNKVVLGGGFGGSFSVNQPSSIQDGCRGRCSKEKSEICVYANGQHECL
CRPGYSRSDPFLSCAKTYTYQLKLVLESINRTMLHFDNNLKDEISPQYRSLASNARMGLK
QALMSTDLSESIQDSQVMGIHPTSESELQSDGVLVDFFVHLAKQQDEDELKNKLMKSLER
NNYILGDSDIIASRFTDSLQAQDFDECSHEGHHDCSEFADCINEKGTYRCQCRPGFIDSE
EDGRICLAERQDCAECSGQGRCVYEPISNEMSCICNKWFTGKECQINLKVVMIVVLAVSI
FMILLVTAIIVVCCLRSRRAKGSITGGPSFLRYRGPSVPASGTLDRAAMIRGDTSSEGSG
NDNFAAGTSTLDGKGGPRGTAGGPALQSYRPYGEGLMIPRAKHQHGPTTASGNNSSSAER
GEAAPNREHQLMDYLDGRGPKKVLPDRDGKMTDTRSSEVLSAGGRTSVSSTSQFRDSLGN
MESAEKDAQEKADSSVAVDVDMTVSEVRSFDETTIHPATRRPAQYYQSDFDHCIP
Download sequence
Identical sequences E9FUM2
jgi|Dappu1|220982|estExt_fgenesh1_pg.C_30506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]