SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|220992|estExt_fgenesh1_pg.C_30523 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|220992|estExt_fgenesh1_pg.C_30523
Domain Number 1 Region: 162-222
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 6.02e-19
Family Tachycitin 0.004
Further Details:      
 
Domain Number 2 Region: 40-98
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000112
Family Tachycitin 0.049
Further Details:      
 
Domain Number 3 Region: 102-151
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000471
Family Tachycitin 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|220992|estExt_fgenesh1_pg.C_30523
Sequence length 225
Sequence
MNSKVLASLVAFCGLMAIVAGASNSKLQIEARDTDLGESDYQCPEGLYVAPHETQCELYY
ICASGGTPTHLYQCRDDLLFDLEYYGCNFKEMVDCGDLLAPFTCPSPNGKFPVKEGACDS
RYYICTDGVSDLQTCPNGGIFDATASSCVATPCATTTTVAVPTAPGPFECPAPNGYFPSP
YSCSQYYVCLEDKPYLYTCPAGLYYNPALEACDWPANVNCNLPGF
Download sequence
Identical sequences E9FUP5
jgi|Dappu1|220992|estExt_fgenesh1_pg.C_30523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]