SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|221339|estExt_fgenesh1_pg.C_40463 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|221339|estExt_fgenesh1_pg.C_40463
Domain Number 1 Region: 163-283
Classification Level Classification E-value
Superfamily C-type lectin-like 1.35e-17
Family C-type lectin domain 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|221339|estExt_fgenesh1_pg.C_40463
Domain Number - Region: 34-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0112
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|221339|estExt_fgenesh1_pg.C_40463
Sequence length 284
Sequence
MVKYLALCVFALTFVSFGYGNVVPSRDDQLAVPSCGGYMFVEDEVVIDGPFSQDCILQFE
TQEDRILAFSVLDGDVKDALQFLNIHDGFDLDSPILKVENQIVHQVSRKDRPTILYTKNS
EAIVRFTKTPTDSNFQLKIQKAVECPLGIGDNTQCGPIVDDVSCHCAVFNTKSFPDMTMY
CLDYKMKLIIFENRTEEEIVQKTWGTQNPYWTSLTDSRRDGTWVWESTMTVLKAGNYTNW
FPGRPSYVANNADDCMLYGGTIYLNFWGDISCATLARGICEVQP
Download sequence
Identical sequences E9FXM0
jgi|Dappu1|221339|estExt_fgenesh1_pg.C_40463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]