SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|222588|estExt_fgenesh1_pg.C_100311 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|222588|estExt_fgenesh1_pg.C_100311
Domain Number 1 Region: 67-130
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000034
Family Tachycitin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|222588|estExt_fgenesh1_pg.C_100311
Sequence length 135
Sequence
MQTTPSVETTMNTQSTATNPESTAMTTTILTTSTIPSEPTTTTTTSTSTTSVTTTVTTAV
TTEVPTTTISASFTCPDTSEKKYPDPENPCNGKYYQCSGGIATLTDCQENLIFNSKAQLC
TPCSLVPACAAECDK
Download sequence
Identical sequences E9G4Q8
jgi|Dappu1|222588|estExt_fgenesh1_pg.C_100311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]