SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|223483|estExt_fgenesh1_pg.C_160004 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|223483|estExt_fgenesh1_pg.C_160004
Domain Number 1 Region: 89-222
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000035
Family C-type lectin domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|223483|estExt_fgenesh1_pg.C_160004
Sequence length 226
Sequence
MYKFFLLVTCTTVVPGWARYNPEQSITQHENKALGVCSSLFPDQYYKDCFELGGKCYCQL
RATPYDPSIFYMETIFNHDRTPAAGRENRLCSQENMTILAIETPEEDKLIYDHFQKYHVN
TTIRLLANTLKTNQRWEWISEWRDGISYENETSTIAPPAPGQPMTYTNWYPGQPSNVEDG
NRCLGLMFNYGIPFEGGYWDDIDCDYMSGDVQGRFYYTFICESVAD
Download sequence
Identical sequences E9GC23
jgi|Dappu1|223483|estExt_fgenesh1_pg.C_160004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]