SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|223524|estExt_fgenesh1_pg.C_160105 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|223524|estExt_fgenesh1_pg.C_160105
Domain Number 1 Region: 2-53
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000178
Family C-type lectin domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|223524|estExt_fgenesh1_pg.C_160105
Sequence length 181
Sequence
MTYTNWYPGYPNNSQPGSSAYVNYNFERGLWFNVNNPSSTYILFICESNGSTGTTTIKTT
TSTEVPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTD
APTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDAPTDALSYRRYRIRNGPVTT
E
Download sequence
Identical sequences E9GBH7
jgi|Dappu1|223524|estExt_fgenesh1_pg.C_160105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]