SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|225009|estExt_fgenesh1_pg.C_290045 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|225009|estExt_fgenesh1_pg.C_290045
Domain Number 1 Region: 160-276
Classification Level Classification E-value
Superfamily C-type lectin-like 7.87e-20
Family C-type lectin domain 0.0016
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|225009|estExt_fgenesh1_pg.C_290045
Domain Number - Region: 43-127
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00109
Family Spermadhesin, CUB domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|225009|estExt_fgenesh1_pg.C_290045
Sequence length 299
Sequence
MTLFPAGCIFITLSLLSSIQGSAIVSRELCGGSMHVVDSVVIDIPLQENWAWEIQTDKDH
ILVFDLVHQDWNFEQAKEFLAIHDGLGKDSPVLRQENQKHHEVGLTANNKLNRYLYSTSS
VAQVRFKNAPKSSLKLRIQKAADCPFSIGVESQCGRVVDETSCYCATFTKRNQPSQTSFC
SSNQMKLLSVETYAEEQAIYAAWGASVNFWTSGSDVYSEGTWVWESTGARIYPGYANWAT
YEPNNNENSEDCLMILNGWYDYTCASTFDAICEVHPPNNTNVSTTQPTVTTTLKAPTTE
Download sequence
Identical sequences E9GLF4
jgi|Dappu1|225009|estExt_fgenesh1_pg.C_290045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]