SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|226709|estExt_fgenesh1_pg.C_610083 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|226709|estExt_fgenesh1_pg.C_610083
Domain Number 1 Region: 132-201
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000178
Family Tachycitin 0.029
Further Details:      
 
Domain Number 2 Region: 196-252
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000863
Family Tachycitin 0.028
Further Details:      
 
Domain Number 3 Region: 44-106
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000654
Family Tachycitin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|226709|estExt_fgenesh1_pg.C_610083
Sequence length 259
Sequence
MLDKHAILIPILLAFSLFQGSSAAGHDLRQKVLPKAAFRLQTADFVCPGSDGFYGIPGGT
YYACVGGTPIQQECPANEVFDPEIKHCVPLAEASCNNGQTTASTTTVSSTTTRTTPTTSV
TTPPTISTTKSTTTTPSGGFTCPAPDGFFPIPGTCDSPYYICVGGVPTLTACPGETIFDP
QTNTCVAPEDASCSETFTCPTPEGFYPIPGTCGSDFYVCVSGSPYISTCPNGNVFDPETL
ICTPPDQATCSNLFVKKSK
Download sequence
Identical sequences E9H1M1
jgi|Dappu1|226709|estExt_fgenesh1_pg.C_610083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]