SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|227615|estExt_fgenesh1_pg.C_790097 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|227615|estExt_fgenesh1_pg.C_790097
Domain Number 1 Region: 683-791
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-28
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 547-614
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000955
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 3 Region: 471-502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000038
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|227615|estExt_fgenesh1_pg.C_790097
Domain Number - Region: 426-513
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0408
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|227615|estExt_fgenesh1_pg.C_790097
Sequence length 792
Sequence
MAMGIYGCGMYIFLNVIAKSEMPVENLGDEPTSAPICDMADECHQQLQNRLETIESAVRA
IVSVLSIHKSELFTTVNKMLEQDQAVREILSRSEFIQNSGVFSTVGSAGLNAAVGENPSD
ATKDISQHGKSVENLKGAIKCSLANLIDISTKDHDLKANQSDAHSIKASVMINGSLEITW
PILSTDCIKFSSGVWIRIYQASEGDDNNKLMPEEAVTALSIPQKCLINNTDASYSIVLYP
QSPSADEKDSCFFSMTKNLTQCSTYAVEVIPNYQSLGGKTLRTEIVVPPNNKQSDESSTK
PLISVIMAHQSNSLVFNWEDNSGCAPQLTSFNLKIFRDGIADKEKAITTISVPRSCLQHS
RKNENLFSLELPADRQTCPIDWKPLDTCRKYRLDVSSQYSNWNSPSSSWEIFTGQEGNYP
VNISDFLRCPKDHYYCPFHGRCIQQIQSISICQSDDVQCDDGRDEKHCDTECKKERFRCG
QQCLPKDLVCDGKYDCLNGSDEGYDCSYAYVCQQFTNASGKFSSRISPKPTFEIHPDRVP
DAVRKTAVLISVQTDHQIWLTFNKFVTYKDKHFIKVYDGPYSSSPLLLSHSGLSKPYSVR
SSSSDLFVEFPSLTSQTIHLYPVYDGWSTNSLVLYDGKPSNEQDNAVIFSITNKMLVHLK
QPKVINEYRAFYWNVSKISSSKCKYYYEGTSGTIKSPNYPMLYPHLTDCRWTINVKPGSK
VRLLFAFFETQEGSDFLSVYDGTTVHSKLLLAKSGSVPTPFVVNSSTNQVMVRFTSDGDT
SFPGFLAVYSSL
Download sequence
Identical sequences E9H7T2
jgi|Dappu1|227615|estExt_fgenesh1_pg.C_790097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]