SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|229736|estExt_fgenesh1_pg.C_2620018 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|229736|estExt_fgenesh1_pg.C_2620018
Domain Number 1 Region: 1052-1378
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.28e-66
Family Complement components 0.000078
Further Details:      
 
Domain Number 2 Region: 1463-1583
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 9.16e-25
Family Alpha-macroglobulin receptor domain 0.0016
Further Details:      
 
Domain Number 3 Region: 760-794
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|229736|estExt_fgenesh1_pg.C_2620018
Sequence length 1640
Sequence
MKPFFGAASSLLLLVLLDSTAAQQRQQQQQQQSPPTQSTRINFQDPIRDNNQRPNLFNNN
IDPFSRRPFGVGDNTNAIFEEPTYFIVASRIIRPSQIYRVAVSILSSPITLSVRASILRN
GVDIGSATQECKPGIPETLLIKIPSTTVPGQYRLRVEGNTDRALGGTAFLNETLLNFSQR
SMTIFIQTEKPVYHQSQIVRFRTIPINTELRAFDDAVDVYMIDPRGFVVRRWLSRQSNFG
AVSLDYALSDQPTFGEWTIRVTAQGQTEEEHFHVEEYYQTRFEVNVTMPAFYFDSDDFIH
GTVMANYTSGAPVRGNLTLKATFKPIRATPLIPDRPGSIRDSVIERNLTFKEFRGFYTFK
YPMAELQRMVPKLDGIELRITAIVGDRYREDYVEGFSTARIYNSSLKLNFLGGSPQVIKP
AMPFTCFLAVSFHDGSILPAERFRYDRLEIRPTVQFRSSASRTLEVREAKALPEQPGIWE
FTIDLRSELAQTTGSNVGTGDKRVKDLVNEISALKLIANYKDGYGERATAEMLAITHYSI
GDKHIKVLTSTRSPKVGEYLILHVRTNFYAETFNYIVVSKGIVLVTGSQSSSPSVTTLSI
PLSAEMAPVATVVIYHVAKYGEVVADSLTIPVNGISRNNFTLTLNPMKDKTGDTVEVVVL
GDPGSYVGISAIDKGFFNMQAGNELSYAEVITKMTSFDESLNGTLRHYWTSREGDAETVV
NYPASTFGIDANRTFEYASLVVFTDAFVVRRPDACNITLGFLACMSGSCYRSERRCDGQY
DCDDRSDEAGCPSNIRRELAQYRLKRINRLLRMYENSWLWKDINIGPHGHSIFSVQIPEI
PTHWVVSAFSVSPKNGFGLVRSSREFAGYRPFYMNVEMPTNCRQGEQVGIRITLFNYATI
EADVVVTLADSPDYKFVHVEEFGEVKSYEARTSRGEKQHLTWIPAQGSQVVYIPIVPTKL
GEIEVTIQAKSLIRKDQVVRRIRVEADGVPQFRHTSVMLDLSNRAWFLQYVYVNVTETPI
IPYEKDRYYVFGSNRARVSVVGDVVGPAFPNMPVNATSLLTLPMDCAEQNMFSFAANLYT
VKYMRLTTQRKREIDRQAFYHLNIGYQRQLSFQHRDGAFSYFRADWDYSSKSVWLTAFCA
RILAEANFNEWENYLYIDPGVIAKAVDWMIQFQSPEGAFYEVAPRFADRKMNSTTSWGFN
DPIRYRNISLTAHVVIALTTIRDLPGELGPRVAVSRSRAISWLDRNLNLLEKFGDPYEVA
IVAYAMMLAKSTSAEAAFGLLQQKAREDGGYKYWGREPVPLPAQRLENQRPFLLPRLPNA
FDAANVETTAYALLTYVGRQELFVEPIVKWINTQRLTDGGWASTQDTIIATQALIEYTVR
HRIREVTSLTLHVEATSNPQLQRTMYITENNLATPQFMDIPNAWGTVKIQARGAGYAIAQ
LSLQYNVDVNRFVTPPAVRAFSVVPRLSFSGRNNSHINYDICSSWTNQRESNQSGMAVLD
VAVPTGYYMQQQVLDEYILSRKVRNLRRAKFLDHKVVFYFDALDGDDTCVKFTFERWHPV
ANMTRYLPVRVYDYYAPERFNETVVQTYELYVMDICQVCGSYQCTYCPTYNHATRGLMTS
SLTMIAALLISLVFTAIYQR
Download sequence
Identical sequences E9HTS4
jgi|Dappu1|229736|estExt_fgenesh1_pg.C_2620018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]