SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|230004|estExt_fgenesh1_pg.C_15190001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|230004|estExt_fgenesh1_pg.C_15190001
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000068
Family Tachycitin 0.017
Further Details:      
 
Domain Number 2 Region: 76-122
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000123
Family Tachycitin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|230004|estExt_fgenesh1_pg.C_15190001
Sequence length 184
Sequence
SAQNIRSDTFVCPKENGFFAHDISCDKYWKCVEGVATLELCGNGLAFDDTDLKNQRENCD
YIYNVECGDRLEVEAPISTRNCPSLHGVFPDETKCDVFWSCWNGEASRYQCAPGLAYSRE
SRVADYYGTLDLDGLRNTEVQAGLAPEAAPVKVAPKKPVTSRPAFRPRPVTEVLVVEEES
LTAV
Download sequence
Identical sequences E9I1L2
jgi|Dappu1|230004|estExt_fgenesh1_pg.C_15190001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]