SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|232075|SNAP_00000133 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|232075|SNAP_00000133
Domain Number 1 Region: 29-260,333-382
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.37e-89
Family Type II chitinase 0.000000936
Further Details:      
 
Domain Number 2 Region: 260-332
Classification Level Classification E-value
Superfamily Chitinase insertion domain 6.54e-21
Family Chitinase insertion domain 0.00074
Further Details:      
 
Domain Number 3 Region: 414-479
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000497
Family Tachycitin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|232075|SNAP_00000133
Sequence length 485
Sequence
MKFSFAVLVLVATLHVSASLSVGSKADKKKMVCYYGSWAVYRPGAGKFDVEDLDPFICTH
IIYGFAGLGYDNTIISLDPYNDLPENWGKGAMVRFTGLKSQNPELKAILAIGGWNEGSEK
YSKMVSSPSERAKFTSSVVEFLLKYNFDGLDFDWEYPANRGGAIIDKENFIRMIEELKTA
FAPHDTGYDIPSMTRILDQIHIMAYDFHGAWETFTGHNSPLYGNELDYGEFVDFNQDFAV
NYWIENGADPSKLILGMGLYGRGFVLNNPADNGFYAPANQPISAGPYTREAGIWGYNEIC
EKFAAEPGLWTVVVDPSYMSPYAYKGNQWIGYDDQNSLKTKAQYAASKGLGGAMVWSVET
DDFHGTCHGNNFILVKTIYETLNGPIVYPSPPTGSTGEFTTEKYSTTTSTRPTTITPPPN
QTCQSEGYFRDPNDCGKYYLCVANGSEWVIYNFECGAGTVFDPSTNNCNFPYNVPGCENY
PGKDN
Download sequence
Identical sequences E9FRW0
jgi|Dappu1|232075|SNAP_00000133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]