SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|232076|SNAP_00000134 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|232076|SNAP_00000134
Domain Number 1 Region: 22-235,307-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.44e-83
Family Type II chitinase 0.00000305
Further Details:      
 
Domain Number 2 Region: 235-306
Classification Level Classification E-value
Superfamily Chitinase insertion domain 5.63e-19
Family Chitinase insertion domain 0.00072
Further Details:      
 
Domain Number 3 Region: 452-519
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000497
Family Tachycitin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|232076|SNAP_00000134
Sequence length 522
Sequence
MSLAIEKDVAKYSSVQKAAEKKKMVCYYGSWAVYRPGNGKFDVENIDPFICTHIVYGFAG
LGSDNMIKPLDPYNDLYENWGKGAFLRFTGLKKKNPELKALIAIGGWNEGSEKYSLMASD
PAKRAIFVNSVVNFLITYNFDGFDFDWEYPGNRGGAIADKAYDIPAVASALDQIHLMAYD
YHGSWETYTGLNAPLYANPRVESGSNLLLNVNWTVNYWISNGAPASKIILGMGLYGRGFT
LASPTQNGFYAYAPQPITAGPYTRESGTWGYNEICEKFKADPSWTVVRDSSYLTPYAFKS
SQWIGYDDQQSLTIKAQYASSMNLGGAMVWSIETDDFRGLCHNVPFILIKTIYESMNGPI
VTPDTTTSTLSTTTKAPTSTTPATTTSTTTTTTPRTATTTTTPVTTTTTKSTSSPSTSST
TTQGTTICGPTSSITTTKSPSIYTTLPPITTTAGAPPPNTLCKSEGLNSDPNDCGIFYTC
INNGQGGWTIYTQRCANGTAFSEALNTCTYPYQVLGCENYTG
Download sequence
Identical sequences E9FRW1
jgi|Dappu1|232076|SNAP_00000134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]