SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|232498|SNAP_00000556 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|232498|SNAP_00000556
Domain Number 1 Region: 616-708
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000117
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 400-489
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000122
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 491-532
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 172-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 5 Region: 530-570
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 6 Region: 578-619
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 44-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 335-373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 297-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 10 Region: 1552-1601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 11 Region: 209-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 12 Region: 256-295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 13 Region: 1035-1069
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000114
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 1191-1226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 15 Region: 1115-1146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 16 Region: 1226-1263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 17 Region: 100-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 18 Region: 994-1027
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 19 Region: 1153-1186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 20 Region: 1073-1107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000524
Family LDL receptor-like module 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|232498|SNAP_00000556
Domain Number - Region: 1861-1900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family Laminin-type module 0.053
Further Details:      
 
Domain Number - Region: 951-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000753
Family Laminin-type module 0.057
Further Details:      
 
Domain Number - Region: 1276-1316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00156
Family Laminin-type module 0.047
Further Details:      
 
Domain Number - Region: 1516-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family Laminin-type module 0.081
Further Details:      
 
Domain Number - Region: 1621-1661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Laminin-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|232498|SNAP_00000556
Sequence length 1945
Sequence
MTMSLVVTESTTPSNVVTIEPTPGPTAAPPVVDSSAGGGGSSSNCRSDEFQCDDGSCVGR
HFRCDNVPDCSDASDEDNCNFLLSNKKPDFGFIKSHCLTPPCPWSNPFRCGDGSCIDAST
QRCNGVAECADSSDEADCVILDCPLIIISFHILTHLFSTCYYDSFSTRGIAKECHSNEFR
CSDGTCIDIRRKCDGYDDCPDRSDEINCICTEYQFKCRDGTCLDNRRRCDSRNDCPDGSD
EEDCRSFSPSLDDMTLGRQRCQPNEFACDLARCIEPAMRCDNFYDCIDLTDELNCTECRT
DQFRCGSGQCIEGDRRCDRTVDCPDRSDESNCGVQCKSGEFSCVSGDQCVPYSLVCDGRR
DCQDFSDEAECRNSTLKNRVLSKCRTNVNATKNDELNLKTYPADQTILQGREVVFQCRDE
GPARAPVRWTRGSGMTLPPSTRDNNGRLEMPNIQPEHTGTYICEAVGYPSTTPGSRVSVY
LKVDPFAEPTTRPPTACGVNEATCMNGECIPKNAVCDGDFDCSDQSDEMRCSLLGCQPNE
YQCANKRCVLKNWRCDGDDDCGDNSDELYCKPSPPGSPCRHDEFQCQSLNQCIPRSFHCD
MELDCQDRSDEIGCSKPTILIPPPPMININIGTTIVINCTAVGVPTPEVVWRLNWGHVPS
KCTMTSESGYGVLTCNDAQIIDQGAYSCEAINAKGSTFAVPDCIVVVKPSADICIDEEFN
SAAVSPADCLPCFCFDHTKECSSSSLYVSQLPPPSDQFQLITLRTDTIRSSSSARLFSSR
DVGSSGTANRAYLRSPSANDGIQAYRRDFNARSEVAFFNLPPSHRGYQLLSYGGQIKYRL
TYRGSGSSIRAPDVILRGNGITLYHESRTRLEPNQPVEVIIRFLPEDWSKGADSRDSARR
EDLMMVLQSIEYFLIRASYVESSVLDTTITNIRMDTAIEQNYNLGQAVLVEECRCPPGYI
GLSCDSCAPGYVREETSSGRYLGRCVAETSCDSSYQWTCPSDGTCIDNRRRCDGRLDCRD
SSDEIDCQPNRSCDPNYEWTCRDGSCIDVRRRCDGQLDCRDRSDEFECPTENCDPSSQWR
CDDRCIDASKRCDGYRDCYDYTDELNCQGCDARLEWRCANSQCINTAQYCDRNVDCADGT
DEVYCPIQGCDLATRFRCANGQLCLDKSLRCDGKFDCEDHSDECNCPGCGSDRHFRCADN
TCIDLSERCDGRVDCRDATDEIGCTYTCDPNTHWTCGDGSCIGVRLFNDGLDDCYDGSDE
FSFSAQCNQAGIVNGSSTSSGCICKDLVTGPRCDQCKPNTFHLNPDNQDGCINCFCMGIT
KTCTASTWFRQQIKTVFTTDIQGFALTDKNRRENIVERVTVNSVSREIVYRDFNRLSNEV
HYWKLSSKFIGDKVTSYGGHLNYTVRYVPQPGGRSSPNSAPDVDIRGNNIRLLHYRREQV
DASKSVMVSVPISEQYWQREDGRPADREHLLMVLADLDSILIKATYTTRTSEASLSEVSM
DIAEERNTGQTRAFAVEQCTCPRGYKGLSCEDCDTGYTRSVQGVYLGLCEPCNCNGHSNE
CDPDSGVCMNCRDHTTGEECELCEDGYTGDATLGTSNDCRPDGGRPPTCSCDPRGSLRPD
CPDGRSCSCKVNCHGDRCDQCREGHFGLTEQNPQGCLSCFCSGVARDCNSAKLWRSQIIQ
QVIDTQHGFTLSERNGVSVPNLRINIDQNEISYTFSSTPARSPKLYWSLPPQFTGNKVTS
YGGQISITQRYDERQGAVGQRFTDSDVILTSGRISLAFVNPNQIQSGQTVTYTVPLRESG
GWRRLDTGLAVTRDDMMRVLSNLQTIEIRATYSYSMAYTSISNVLMDTAVPNNNGQEQPR
DVEECRCPEGHIGTSCEECATGFYRDRSAGLSGQCRRCPCSSNEESCVQQSDNRVICNCR
RGFSGRNCEIQVSHGSRSDDLVHRS
Download sequence
Identical sequences E9FR26
jgi|Dappu1|232498|SNAP_00000556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]