SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|232871|SNAP_00000929 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|232871|SNAP_00000929
Domain Number 1 Region: 94-174
Classification Level Classification E-value
Superfamily HMG-box 5.11e-26
Family HMG-box 0.00023
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily HMG-box 3.01e-24
Family HMG-box 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|232871|SNAP_00000929
Sequence length 190
Sequence
MPRAKADANKPRGRMTAYAFFVQTCREEHKKKHPDENVVFSEFSKKCAERWKTMSDKEKK
RFQEMAERDKVRFDDEMRHYEPADKGAGRGRKRKQVKDPNAPKRSLSAFFWFCNDERGNV
KAAHPEYTVGDIAKDLGKQWGEVDESTKSKYEAMAEKDKARYERENNAYKKKLKGEAEEE
EDEDDDDDDE
Download sequence
Identical sequences E9FSK4
jgi|Dappu1|232871|SNAP_00000929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]