SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|233041|SNAP_00001099 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|233041|SNAP_00001099
Domain Number 1 Region: 33-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000403
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|233041|SNAP_00001099
Sequence length 151
Sequence
MELALICFSRGPSLGETRGFFCTQSTEVKLESGCLKPETPEHGEMFVLWSGLLVQFRCKS
TDYKLVGAAAVICRNRTWTQDPPVCVHHHQLEAHLASQQQQQQFRALIKGRDNCGEARAE
PGYNILSECWPGVGGGVTSGSLHVVPTSLYC
Download sequence
Identical sequences E9FT12
jgi|Dappu1|233041|SNAP_00001099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]