SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|233379|SNAP_00001437 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|233379|SNAP_00001437
Domain Number 1 Region: 4314-4442
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-32
Family Cadherin 0.00038
Further Details:      
 
Domain Number 2 Region: 5037-5056,5112-5264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.41e-31
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 4429-4532
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-30
Family Cadherin 0.00075
Further Details:      
 
Domain Number 4 Region: 2703-2839
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 2192-2322
Classification Level Classification E-value
Superfamily Cadherin-like 9.82e-29
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 4534-4646
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-28
Family Cadherin 0.00077
Further Details:      
 
Domain Number 7 Region: 1801-1909
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-27
Family Cadherin 0.00096
Further Details:      
 
Domain Number 8 Region: 3445-3561
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-27
Family Cadherin 0.00087
Further Details:      
 
Domain Number 9 Region: 1215-1337
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 10 Region: 3664-3773
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 11 Region: 2597-2709
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 12 Region: 3991-4100
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-25
Family Cadherin 0.00095
Further Details:      
 
Domain Number 13 Region: 1695-1801
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-25
Family Cadherin 0.00092
Further Details:      
 
Domain Number 14 Region: 4217-4319
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-24
Family Cadherin 0.00072
Further Details:      
 
Domain Number 15 Region: 3234-3343
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 16 Region: 2914-3035
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-24
Family Cadherin 0.00063
Further Details:      
 
Domain Number 17 Region: 1591-1702
Classification Level Classification E-value
Superfamily Cadherin-like 4e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 18 Region: 979-1105
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.0022
Further Details:      
 
Domain Number 19 Region: 4634-4757
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 20 Region: 3761-3885
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-20
Family Cadherin 0.003
Further Details:      
 
Domain Number 21 Region: 3561-3659
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 22 Region: 1328-1435
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 23 Region: 4102-4214
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 24 Region: 3345-3450
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 25 Region: 2816-2920
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Cadherin 0.0034
Further Details:      
 
Domain Number 26 Region: 3023-3155
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000138
Family Cadherin 0.0019
Further Details:      
 
Domain Number 27 Region: 2511-2609
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000328
Family Cadherin 0.0053
Further Details:      
 
Domain Number 28 Region: 3869-3989
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000871
Family Cadherin 0.0049
Further Details:      
 
Domain Number 29 Region: 1431-1535
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000106
Family Cadherin 0.0042
Further Details:      
 
Domain Number 30 Region: 2409-2500
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000957
Family Cadherin 0.0052
Further Details:      
 
Domain Number 31 Region: 3139-3246
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000742
Family Cadherin 0.002
Further Details:      
 
Domain Number 32 Region: 1110-1227
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000814
Family Cadherin 0.0053
Further Details:      
 
Domain Number 33 Region: 1914-1975
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.0025
Further Details:      
 
Domain Number 34 Region: 5417-5456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000016
Family EGF-type module 0.01
Further Details:      
 
Domain Number 35 Region: 5311-5456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000345
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 36 Region: 4748-4843
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000257
Family Cadherin 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|233379|SNAP_00001437
Domain Number - Region: 2109-2144
Classification Level Classification E-value
Superfamily Cadherin-like 0.000214
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 866-991
Classification Level Classification E-value
Superfamily Cadherin-like 0.000314
Family Cadherin 0.017
Further Details:      
 
Domain Number - Region: 5054-5087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|233379|SNAP_00001437
Sequence length 6466
Sequence
MFINSRVPTGDQQKASDGKEVHEMLQLEYFPLIPIDELENADENTWLYVFHIRPQKLVHV
PPPINITLPGLNSTINLKDNSQWLDNLSPGDILLQDPISQRDESSQLNNTYKAGDTLNGA
DVLNATVIIDEPSTKIKLNTTSTVQGELNATFPVELNGPTEEELSPCNNNVYNLNSTFQT
QPAASDRSYSVGPAPSKTVLNATYVEDEPVQGPITCLDELDELNEIEDEDRCDFNEDGFR
KPLMRGAVPKRPLIRTSTWNYELTASPKKEITPPSSKITPPSSKITPPGANGLTDIEKMA
KHQEDILAQTSTPMGQRRFTAFQRPAEVDHNLGSPIISLAEGIVNFGPPIPLRESIVGNA
NLDSTLDNSNNRTRGIQGHLTFDKSQNSVENQSDSPSSPASSPYSSQSLESETGVPATTQ
ELIRRSMPNLNNQSRMRLPQPSSLAGNLNRQHGSDSGLRPPSMGGAVRPPVHNGSALGLM
RPQFKVPQPPPPVETAMKTTRGTVTTTEPVRSSQMQLQQPRSSGIAPPVRSSLLPNSTSK
LKPLQLVAPRASGAALPVKAVVPAAKASSDELNSTVIMEKPSVVLPPAAPANSGIPRPSM
LSRIPMPRTMNTTPTFRRDSDRGAAQMIVLWSHGSILNQSRRGPYYSDKEGRQLKFLSKA
KKCQRGDCEQSTARENSSSAFQTNTQKRTSQPVSPPPKERGKIRVQVITYFTPDIVSRLQ
TALCGHSFGMSMNNFPSKLISRKEEEDEKESRMSVLSLKAPVRGQLQFSETSTKSRSLLT
ELHKSRQSGREMGPGNVPTDLGRNMRMDGTTQDRDDPKRRRRRRRPLEPIRRRLHRTTTT
CCCWMQVFVIVLYVAVGLADGRKLSFTRPRYNATIYENNIGKSYAQPETERMGIQLPEVA
SATDIRYRIISGDKNKLFKAEARQVGDFSFLLLRTRTGQVDVLNRERTELHKLRVRAMLR
SAVDGSDSDLPDAEADVWVYVQDTNDLSPLFYPSEYEVNVPEDSALHVSLVQVKADDADV
GVNGEIYYSLAEPSDTFAVHPLTGVISLTRPLVFADQPFHELAVLASDRGPKLGAAVVGA
SSRARVRVHVLRVNQHEPRIHVRHLPEVVEQSQVDVYAVVRVEDADAGPSGQIRSLDIID
GDPDGYFRVQRVGTGGQPGNNNDKNNNNNNNGAAEFNIAVLKLLDRERAPMGYNLTLRAV
DGGTPPRNSTATLHVTVSDWNDHAPVFDREHYEVRIVETAPVGTPLIRLRVSDQDQGRNA
QVQLSIVGGNQGGHFRINPTSGVLYTALPLDAEMRAEHILTVSAIDQGTAGTRQQSSAKI
TVQVLDANDNDPIFYQQPGGVLEIQVDENEQAGAEVARATARDADAGENAYISYSLANLA
PVPFEVDPFTGAIRTTETLDYETGRRRYLLKIRASDWGTPYRRQSELLVTVVVRDVNDNR
PQFQRVGCVGRVPRTTAIGSELLTLSAVDFDQGNAVVYRIVSGNEDGCFSLDSSSGALGV
ACDLSDLGISERFVNVTATDGQHFADIMTIRIHLTGGVRGEDESRFECRETGLDKRLLEM
INTAAKRQQAGGDDSDPVTELPPLPSRYGQNVHTPEFYDFPVQVRVNESVSSGTPLIRLR
ARDRDHGYNGLLVYVISGGDDDSAFQIDTESGLLRVAGQLDREKRAGYSLNVTVFDLGQP
QKSAWRILPVIVTDVNDNPPRFDRPVISVSIAETAQIGTSVAQLSANDADEGDNAKITFA
LAGGESSDLKLDPNTGLLTVSGQLDRERRDFYEVVVIARDGSPNGPGLTAKALVRVRILD
VNDVTPRFARPWQVVKIREDMPVGAVVALVEATDPDLGLGGVVRYSLASSYASEIVEQFS
IDKVTGTVRLARRLDFEDRSVYNLTVRAKDRGSPSLSSEAYLAVEVVDVNENLYAPRFED
FVTEASVRENAPPGTLVAKVTATDADPSGDDSRLSYAIRGGTGLGLFSIDNEADVVPTSA
LNPTGYAVVSPPMTAMNHDRQGAAGGGEDEEDEEWWPYNKDCAKSVVVVVAVALPSLAVL
WSRLTPGMLGYMFMGRLMITSAARAVSSSSSSPSKGFSCLAITSLLEATGILQEETEEQK
GEEEGKKSTIRTRAVLDRETTPHYWLTVVAQDHGIVTLSASIEVSSSPQVSFRMNSMWEQ
KKQHDPNQLTQHGNVYNTSLRVELAGGDQVFIEVLDENDHIPLTAEPVYWVHVAENSPPK
TPVARITAIDGDRNSRLTYQLKAGNPQSLFDIDPNTGNITTTGRRLDRENLTEHILEVMV
IDNGNPTLSSSTRVVVTVDDVNDNAPEFLERFYKIQIPATVISHPESAVLQTTTLTLASL
NDSNFPWVAITKSSLRSAAVCRRHVLQSFLDWRCKSAISPFDADNETEEWLDPESNSPTE
SNSTSLWITSRLDNLLGSPVFRVEALDRDAGENGRVEYSLMETASTKGRFRIHPHSGIVY
AQKSLAAGQEFSFSVRASDRGRPARNATTRVSVAVIGVPSQSANPPELSTDNSRRADVME
SDPVGHAVAFITANDPDGDMLWYKIEDGNIGDKFAMQTTGNGKVYVAQPLDWEQQSSYLL
NISITDGHNTIYTQLEITVLDVNDHAPVFSEQHYRAEVSENAEVGAEIITLNATDADQDK
RVFYALHAASSASSLRKFKVDSIRGVVTLAEKLDRETMAQHLLTVSVKDQGTPSKRNFAR
LLIDVTDHNDHTPEFMSELVQVRIFETAAVGSVVTVMLAIDKDRGVNAKVTYSISSGNVG
GAFVIEPDSGLIRVNQPLDVGTAHEYMLVVKASDGGSPSLSTSCRVHILVTMAENDPPKF
LQSEYTADVFEDASGGTFVIQVEGRSISSLLFEITDGNGDGSFTINPSTGIIVVSPRGGL
DYETTKHYNLSISAMNMAGSSARCLVHVHVSDVNDNSPTFSQELYEGTISEAAAAGSLVF
QRLSSAPLVVSARDGDSGVNALLSYDIVEPRAAQLFAIDSNTGAVRTLAPLDREQLARVE
FTVQVSDHGRPRRNSDQVARVSIVITDVNDSPPKFIGQQLPYSASLLLPTFAGVAVVRVR
AEDPDVDINSTLTYEITGGNGAGKFSIDRRTGWISVSDADGLSGSNFYTLEVGVSDGKFS
TATKVEIQLEKMLASGLAFAQDKYTGYVTENSTRGATTIVALNVLGTHLNEHVTFSILNP
QGLFQVGSTSGVVQAIGQVPFDREVQPRYVIVVEARSERGDGEKPRIAHTRVEIEVTDIN
DNRPAFFNLPYYAVVSSEAPKGSVVTKVQAMDKDVGENGDIRYELLRGSGELFRVDRRTG
EILLRHVLEGQQGHSDYELVVAAYDGGTPPLSSEALVRVKVVSKSQPVFGQQYYSASVLE
SADPLSPVLSVQASSPSGRQLIYSIVSGNEGEEFAVDFNTGLIYIVNRLDYEVRSKYELL
VRATDSVSGAHSEVPVSVSVEDANDSPPEFSNNEYNVTLSEATPSGTVVLAVSAHDLDSG
INAQVVYRLLAETNGGQDAAVAVSAASAEFFHINPEDGTLILVRSLDRETQSLHHLLVMA
SDQGNPSLSSTAHIWIRVEDVNDNPPQFEQRSYRCVLSEDGKRGQFVTMVTATDPDVSDQ
TRLVYSLTGGNDQQMFNIDSKRGTVTLGNLHRFGEQPNYLLNISVSDGVFTSFASLQVDL
LSTNRHSPSFSRPLYDVEVMENLPAGTLVIQLNATDLDRDDFGHITYSILSTFATETFRI
DEETGDIFTRRPLDRESRRVYEIPVSAFDAGGKSGHTTLRVKVGDANDNRPKFLLAEYRA
NIHANYSVGQPFLKVQAIDLDVDNNAKISYSIYESNGTRASDTFDINPSTGELFLKQNAL
ALANEVFQFFVRAEDHGSPVLGTEAPVDVLILDPQERAPTFERTSSKYFISESAPVGTTI
ARVKAVSSGEPLHYTIVPAPKNPDIESGNRDDDQDLPSPFFSVDDQGQIYLSLPLDRETC
DIHIITVVASTDASPPVIAFTEVIIQVLDSNEHPPEFESNPYQVVVAENSEKGSSVIRVS
AMDGDRVTGAYGDLRYSFGHNMAPELANIFRLDSVTGWITTLGLLDREQCDRYVLPIIAS
DNGTPAKLTSTTAVVIEVRDYNDNPPQFSQSHYVAAVNEEALPGTVVVRLTTTDRDREQG
RSDSSSSSMQHQQQPQLQYYIVSGDPRSQFGIRQGEVYVERALDREEIGSYSLQVLATDG
FFTATTHVTVDILDDNDHAPVCTQHRYHELVSEATAPGTFIVRVRATDADEGANAKMKFY
LTGEAAEYFFLDANSGQLKTLKPLDRETRPIYTLTAHVQDRERPQWECTSEVVIALMDVN
DNAPSFNQDWYTFAVPEDAELRTIVGKIHATDSDLALNRKIRYSMVTSTTSLAGQNSFAI
DAESGIVTVAKGLDRETVPSYNLTVSAIDLGTPSLLSTVVVTIVVTDCNDNPPQFSRKLY
AASVAESSAIGAEILNVLATSLDIGVNAEIKYSIVGGNEHRHFAIDPLSGVISLAEPLDY
ERAREFYLTVQALDGGVPPLSNHAAVNITVLDSNDNPPIFTQASYSAAIREDAIIGETVL
RLNAVDLDGGDNGRITYTLLNGDRHAQFRIDSSTGLLTVSGQLDRELITSYMLEVEARDN
GLPSSLASNVLVAVEVTDANDNPPAFSQVNYTAIAQEDKPLGFVILKLLVTDADGPTNAG
PFTFEIRSGNVDNAFRIDGNGSLRTARRFNHKVRDHYVLQIVVFDNGSPPLYSDTWVLVK
VIEESKYPPIITPLEININSFLDEYAGGVIGRVHVNDQDPYDTLVYSLVEEKGYHHSSVA
LFELDSEDGTLIAKPGLDVGAYTVNVSVSDGKFFTYSSVKVNVVLISDEALQNAIILTVR
DITADDFVTSYRKNFLKAVRNIMNVRTKDVFIISIQPQVTTGQQSSKGANNRTRRADETS
PLRKTAAVTRLEPMWRVRDPARQSRPNVDILFSVQKPSGGFYPPSIVRKQLLDNVAELEA
TIDHHRISGAVQGFCTASFCGANGKCYDRVVLDDTMTVAITSDISSFVAPRHKYKPTCMC
KDGYAGEKCDVVANECARNPCPDSRICRPESGLPGYSCRCPENHPGCVNELTQITSCKDA
ASGCYQPSHPIFFAGKSYAQYSLGSTIERHLLLTLRFRTVHPTGNVMFASGRIDYSILEI
VNGEVQYRFDCGSGEGLVRVTGLNVNDGAWHDIRLERHGRVAELTVDGSYRSQGEAPGVN
DILNLEPISDYVFFGAEVRTLDDVRMGFVGCLDEIRFNDNLLPQHLPSNSPASSLNSLNP
NSASQSVTLKRFTNVEFVCRVPLERPGVCGTQPCINGGTCTEMVGVLPGYQCTCRPRFMG
SRCEIDSDPCASSPCLFNGRCYNLNNDYRCECPARLSGKRCEYGRYCNPNPCKNGGICEE
GGTGPICKCRGFTGDTCSVDVNECEPSPCQNGGTCVNIVGSFQCLCPINATGHYCTELAL
KNDLITSNLFLNNLSLLEIVGFVVGLIGFIFLISLVSCWWRKSKRSRGSHRSRSMNDSNG
KEMVPLNSTRPMDLSEFKRGSKMSNLEATNQVPPMLPPRPASYTPSVSEPTYLPLNNLDT
IRSYGSAADELETYPMLGMPPYNGNGMGSVGGHNNPDYHPNLNRPAVVGMASNGGSVMGG
GGCLSSPPLLMPALDALSDSDSVHKPRWSDLESNLKGSYYEAAKIHNDLKGKCSETGSAT
NRSLHNHHHHHHHLNGNHYGHTGGLLLSNVKSTNKDTTTASSVSPTVSANVDDCARVQRD
ALRASSSQAVTQSPPSPVAGGLGVSSSYNCSISPLPTPPPSPPAIPPLPRDYAEFELSLQ
TLMRQTALLSRPSPSYHWDCSDWANQSQNPLPNITEVPGSEIPDSSSFHSNESNESNGNN
THQHDPLHNGMMMTISPERDLDTLVEDPKAAPTLNGFRSLDSDCGTDIEMESNGTNPFRS
RQPPSFEEILANSGLRLSDLAVVSIPNSDGGCSDSEAPSESLPPPGNYSRHPNLYLPPYS
IASETEAEDMSPVRNNNNGRQRNGFGNRLGDHHDDDDDSSPSSSSSFASQIHRPSANLRA
PGTGASAGTQSAHDRVSSLMGSCSDVSNLCDIEDSEFEGEDVRPRMPTAMTTIHKPGQPI
QTDGFMFKNNHRLAFFSRPKKFEICLNLKCCYLPLNDVIWIGPDGGFGELFENSGQFGSE
VGPITDLIRHAVQSGHDEREEFSRVGFAFMTHYFMRPFWALDIWANSAGDLLYGPVNILL
HFDEIQLNRDSIFSVESERMDVAKSKNWYIIRLLYKMFDSSTEKKKKRGQKVKWRQLRRV
VKSKPPPSSSSDSSLPMSADIDDLLTLAGKELRSCNYSSAYKRGKKETMSVLKGPMDSMD
ARMIGPRVNSIAMRLLDPPDIDVYVSALSSLKGRGGRGGGGKPDVHQNLLGSFSKKSFGT
GGGPLVAGVIGESASLKEAQAADGRKGEKKKKKYNKRKKKEKKESS
Download sequence
Identical sequences E9FTX5
jgi|Dappu1|233379|SNAP_00001437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]