SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|233473|SNAP_00001531 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|233473|SNAP_00001531
Domain Number 1 Region: 139-186
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000818
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 2 Region: 97-126
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.0085
Further Details:      
 
Domain Number 3 Region: 45-81
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000596
Family Ovomucoid domain III-like 0.014
Further Details:      
 
Domain Number 4 Region: 197-244
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000018
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 5 Region: 252-281
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000263
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|233473|SNAP_00001531
Sequence length 304
Sequence
MHSTAVSMNRLSFVLLLVALALLVLVSSSPSGVQGVPQQIPQQTDRPQCVCSRQWAPVCG
TDGKTYENEGCLRVQTTKCGTEQSLVSEAYEVPQEQDPSCNCKKNYAPVCGTDGKTYSNE
CVLSVETKVLLKAGIGRKAICVCTLQYEPVCATDGKTYGNACALECSKKDNPGLQLSKAY
DGACEPTKKVKRAAAECGCQFKLAPVCGTDGKTYDNENCMEVEVTQCGTVIDSPIRKAHD
GECKTTPIKVSETQCGCPDNFAPVCGTDGKTYPNAACMINTLTKCGTVKSTVTIARNGAS
VTLE
Download sequence
Identical sequences E9FU53
jgi|Dappu1|233473|SNAP_00001531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]