SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|234097|SNAP_00002155 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|234097|SNAP_00002155
Domain Number 1 Region: 498-530
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000982
Family LDL receptor-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|234097|SNAP_00002155
Domain Number - Region: 214-259
Classification Level Classification E-value
Superfamily SEA domain 0.0929
Family SEA domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|234097|SNAP_00002155
Sequence length 534
Sequence
MGKDESIKDDYGFTRNSTPTTNLSQEESPTYSNYGRSPPDQRRFAIALSELPALNFYNPL
LNNPSSSEYIASVRSSIRSIDEIASAHLSMHPRLASDGTIGSTNLTSASMLSPYWSQHSV
KSVKSVDSSRASETNPKSSVTFSSNFVSCRQAAKSILGFCICMWSVLFLGVTIATVIYFT
GKGGTLFQPPQAPAANIIYGEFHVFNHSIMFETFDGSSVNTTLFKDLTNELHQKMDRSFQ
SSPLLSALYNRSAIFGVVPNISLKDPLIRIQFQIHLNHADVMVAEKMAHAFTSDLHRKEG
HYGHTSENWSINLTTVKFAASWGQWTQWTPECYSETSCDPMRMQSRNRRCLLRDKRSDEP
IESTANLPNNVITPCIAGSTVSAADIEIRPCSCAATRFRTPRPRISFSVVRPTKAGQTHF
RFSNTSIATFDQLCSQCRSGEVCVARLEEIVPVCRWAPNPEDPSGCGGFCRAYTESCLPL
GSNSFKCEGVSECLTDIEWRCGDGFCIHNSKRCDRDYNCFDHSDELDCGNDEFH
Download sequence
Identical sequences E9FUK1
jgi|Dappu1|234097|SNAP_00002155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]