SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|234105|SNAP_00002163 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|234105|SNAP_00002163
Domain Number 1 Region: 518-582
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000262
Family Tachycitin 0.03
Further Details:      
 
Domain Number 2 Region: 415-480
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000201
Family Tachycitin 0.023
Further Details:      
 
Domain Number 3 Region: 29-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000837
Family Tachycitin 0.013
Further Details:      
 
Domain Number 4 Region: 353-419
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000889
Family Tachycitin 0.035
Further Details:      
 
Domain Number 5 Region: 268-332
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000112
Family Tachycitin 0.054
Further Details:      
 
Domain Number 6 Region: 110-175
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000785
Family Tachycitin 0.026
Further Details:      
 
Domain Number 7 Region: 233-261
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000165
Family Tachycitin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|234105|SNAP_00002163
Sequence length 600
Sequence
MNKLSFILFAFAALQCSSLVNADINLGVSDFQCPPGHSIYPHPQQCELYYTCYNTEPTYL
WQCRSNLLFDLVYDGCNWPEQTYCGNRTRPDQKTTTNIQSSVPITEATPNSPKPITCPDD
GFYPAYTDSCNPVFYTCLDGYPFSTNCPSYGVFEPVAKKCVSPNNSACRTATPTSGTNST
AKSTTQGVTVTSWLTTSPATPSKTTMAQTTATARTTMAQTTPPKTTTTAGGQFVCPGSGN
YPDPSSCSHYYTCDNGNAYHFLIGVFMERFTCPTSDGFYSDGQCTANYYACVGGIAYPQT
CPGTNNVFDPLISKCVSYDVASCRITTTTVAPTTTRVTFTSPATVPTTTVIKTTPVGPTF
NCPSNEGFFPIPGTCGPDYYVCVSGSPYVSTCPGESIFDPVTLICTSVEQASCKPVFKCP
SPDGFFPVPGTCGNSYYSCVGGTAYLQNCPGTSVFDPATNNCVAEENASCRTTTKAATPT
TTPTTTTPTTTTTRTTTTTPTTTTPTTTTTRTTTTTTTPTTTKPPFVCPGTGQYPYPGSC
TLYYVCSGSNYIVASCPAGQVFNPSTEYCEDPINVPGCYFDPVQFFQDLQYVGVTGGPSL
Download sequence
Identical sequences E9FUK8
jgi|Dappu1|234105|SNAP_00002163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]