SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|234486|SNAP_00002544 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|234486|SNAP_00002544
Domain Number 1 Region: 202-256
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000144
Family Tachycitin 0.021
Further Details:      
 
Domain Number 2 Region: 33-85
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000262
Family Tachycitin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|234486|SNAP_00002544
Sequence length 288
Sequence
MLIYLVLLGIVQALNGDQKTAFQSARFYDKAGICKGTGYNRNETDSSQFYRCVDYKGNGK
KYVIFKFSCPPALEFDENVSVCVLSRKSPSPVINNSNPTTTLTPLNVQTDSSPQLSSSPG
SETEILTLVPPSTSTNAVAEFSVEPSSTGVPSTFVFSPDSVIVPGSIFETVTSSPNVEDK
EFQTAGVVVETSDVLIPTLGMDCISNKLYRLPNSDCNRFYQCHQRSVNIFSCAPGLVFDE
GAQRCLLLEESSCDQQFTKPIADGFFDSSEIDCTSVRSLMADHRDFEK
Download sequence
Identical sequences E9FWQ7
jgi|Dappu1|234486|SNAP_00002544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]