SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|234882|SNAP_00002940 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|234882|SNAP_00002940
Domain Number 1 Region: 224-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.11e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 109-177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-17
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 62-120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000983
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 167-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000222
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|234882|SNAP_00002940
Sequence length 293
Sequence
MYQDKVSLHMNHWILFSESCYFGGVPCNSQQHMCNHQCYEFRFGVNGVGGGCRYWPFATQ
PLKSSYGFGETIQFSCRLGYVLEDPQMSALTCADDGQWDEQEIPVCEPIRCSDVQVPKHG
TVSGTSSILDSRITFSCQEGYQLNGEEQITCRPDGTWSHPAVCVTRSCGDPPNIDNGFAV
VRGPGVGDPISYSYQTGHRLSVVESRTCLSNGRWSGEDPACDPVVCAVPEAPGHGSWTVG
GFVPGSTIRFQCKPGFTLVGSATVTCLTDKSWSDRPPSCQQITCRPLRDVSGQ
Download sequence
Identical sequences E9FXP2
jgi|Dappu1|234882|SNAP_00002940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]