SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|235029|SNAP_00003087 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|235029|SNAP_00003087
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-17
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 18-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000432
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|235029|SNAP_00003087
Sequence length 180
Sequence
MYQDKVSLHMNHRIFSESCNFGGVPCNSMQPLKSSYGFGETIQFSCRLGYVLEDPQMSAL
ICADDGQWDEEKIPVCKPIRCSDVQVPKRGTVSGTSSILDSRITFSCQEGNQLNGEEQIT
CRPDGTWSHSMPVCVTRSCGDPPNIDNGFAVVRGTGVGDTISSTPVRSDIAFLESNLEHI
Download sequence
Identical sequences E9FY11
jgi|Dappu1|235029|SNAP_00003087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]