SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|236047|SNAP_00004105 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|236047|SNAP_00004105
Domain Number - Region: 53-88
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000153
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|236047|SNAP_00004105
Sequence length 108
Sequence
MTVKALSFFLLMAALSMTAESARKWKEGDNGLVRWDLDCTFESSVHIASKDIPGDQCGRF
CLANKDCTHFTYKSGTCYLKRSTIHWQEEGEYLSACGFIPSRTSQKIN
Download sequence
Identical sequences E9FZT3
jgi|Dappu1|236047|SNAP_00004105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]