SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|236223|SNAP_00004281 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|236223|SNAP_00004281
Domain Number - Region: 47-89
Classification Level Classification E-value
Superfamily Kringle-like 0.0785
Family Kringle modules 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|236223|SNAP_00004281
Sequence length 126
Sequence
MRGSQIISSVLYYTAAIELLCAESSSKLACQNHSSGRYDHTSQKKDLTWLSTTHSKAYCL
PTCALCSDLDFCAQPSTDGHPKCYYTTTSRQTPPRRSHRTEEEDEEEVDDAQIIIMIIFA
TYTYAD
Download sequence
Identical sequences E9G1J4
jgi|Dappu1|236223|SNAP_00004281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]