SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|237406|SNAP_00005464 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|237406|SNAP_00005464
Domain Number 1 Region: 280-536
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-39
Family YWTD domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 608-825
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-30
Family YWTD domain 0.00054
Further Details:      
 
Domain Number 3 Region: 105-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 19-58
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 61-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 950-989
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 233-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000312
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 151-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 9 Region: 544-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000008
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 899-930
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000287
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 11 Region: 854-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000352
Family EGF-type module 0.015
Further Details:      
 
Domain Number 12 Region: 191-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000733
Family LDL receptor-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|237406|SNAP_00005464
Domain Number - Region: 998-1034
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0049
Further Details:      
 
Domain Number - Region: 1055-1085
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0942
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|237406|SNAP_00005464
Sequence length 1305
Sequence
MILSMWWMLVFVIRLPGFVAAVCDGNEFACKSGRECVAAKQHCDHVIDCSDGSDEIECNY
PCRSPHMKQCKDGHCIAMFFFCDRENDCGDWSDELNCTGTSSGLTFNCPSNTFHCEGQVC
IPQNWVCDGQDDCSDARDELHCNTSMECKKGFQCGKECILNQWVCDGVTDCADGSDEKEC
GPGSFMNHNCLLPEHGWFSCLSKGTKKCMPISRACDGYADCDDRADEGGQCNIDECSMDP
PMCSQKCANNRGGFECSCSSGYTVGTRNNRSCVANGPEPILLITTNRDIRYTSLPSKEYG
LVRSGISQAHSVAADYEDGVVYWNEKSKDKAGIYKSMLDGSAFQYAVSVGVEIVEDLAID
WVGRHIYFADSGRKHIVVCDYRATICSVVISGKLDKPRAVAVYPEESMLFWSDWGSSPHI
GSAGMDGSQRTNIITKDIIWPNGLVVDETIQRIYWGDAKLNRIESSRIDGSDRKILPVKV
THPYALDIFENTIFWCDPLEHEVLSVNKFTGKDYKILMKEASLTPTGIHVHHPSKQNHLT
NPCRNVICSHLCLLSPSVPGYKCACPVGMTVNKDGRNCESISAHESSIVIATFTDIYRMT
HHQIGKNSIFRLPTRNVENIGALAYNPLGPSIVYSDMIQRTIYSFDLDTYRQTVLFENVD
MVEGLDVDPFTENIYWTEVTRGTVVVGQKNHDGGYDRLVLVRNLYSPQGITIGSTSGRMF
IVEGRISHVISVWHMDGTNRQELVQVYGTVSAMAYDGKHLYFSDSLRGTIERIEVNGENR
IILRSHLGTPVAMDVSADSVFWLTQSSTRISWLNKQDPKTVRGFVIDASENMTVQYRLMS
VIDLSDFNSHDHHCLGDTGGCSDICAPTPDGVTCLCPLGKVLGEDKHVCTKADCVGVEWF
KCQTSCIPVKYRCDGINDCALGEDELQCRNTTTEVSCNDKSDEANCTSTHSVCSSTQFYC
SNSHTCIPLSWVCDRDSDCQHGEDEDSSVCDNVDRKLICPDNYLRCPQHSACMPRKTLCN
SIAGCEHLTNEELCAKLNDLIVDKMKPEKPKNSSVSCPRYFFQCRPDLKCYSRKLVCAGD
AACRKLSVKSLCERLKRNETSRAYTQTSETLREVSSSTTTPKLTTQHALHHNSDFSNAMP
SFEASSIRLPSQVAQVVAEDIFSQIEETLQAVLDGPVHVLSRLFTRKGHNIDFATIFSMD
KTPVPINPVWDSFTNKTRFVEDLHIQNGNRLVLWKIFRPQAYSSDGSLRTVHHMELRTLK
KMGFTFIVVINLTSWIELSEAEKILFVTQQLDLVLLNPVLLLLYF
Download sequence
Identical sequences E9G3U7
jgi|Dappu1|237406|SNAP_00005464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]