SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|238364|SNAP_00006422 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|238364|SNAP_00006422
Domain Number 1 Region: 30-491
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.62e-160
Family Family 1 of glycosyl hydrolase 0.0000000052
Further Details:      
 
Domain Number 2 Region: 622-770
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.63e-27
Family Fucose binding lectin 0.00036
Further Details:      
 
Domain Number 3 Region: 787-837,872-948
Classification Level Classification E-value
Superfamily C-type lectin-like 7.71e-17
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1063-1131
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1180-1249
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 1239-1304
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 1122-1187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000334
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 8 Region: 947-1015
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000057
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 1381-1445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000106
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 10 Region: 1489-1560
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000111
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 11 Region: 1336-1391
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 12 Region: 560-626
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000292
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 13 Region: 999-1059
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000117
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 14 Region: 1437-1488
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000709
Family Complement control module/SCR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|238364|SNAP_00006422
Sequence length 1736
Sequence
MRAVFVLCLLSCSGYFSQGEFIEDTITYGSFPPGFIWAAATASYQVEGAWNVDGRTPSIW
DTFVRTPGTIADQSTGDDACLSYYLYEQDVALLKSMGVSHYRFSISWSRVIPTGVGASNP
LGIQYYKNLIAALKAAGIKPMVTLYHWDLPQVLEDQGGWQNPEIATWFEAYADLCFEQFG
ADVEYWITFNEPWCQSYLGYGSGSKAPGIKQSGTQDYIATHNQLRSHAKAYRLYELKYKQ
TQKGKVGITLNISWAEPEDNSTSAAAAAERSLQFAGGWFANPIWGPNGDYPQVMIDLIGR
KSTAAGLPQSRLPVFTEAEKTELKGSSDFFGLNFYSSEIVREELFDDTLVDYTTDKDAVA
YQDKENWYGTASTWLRITPWGIRRMLNWIKERYNNPDVIITENGMSDRSGFLDDSMRIYF
YKYYINNVLQAVQDGVNVIGYTAWSLMDNFEWERGYLERFGMHYVNFTDPARPRIPKASA
NYYARLIQKNGFGPEEICDSANSERKLENAKIDHFDVIEELLTTITTRASQKYRRTKFVI
FNLTGFLVFQQNNPGAGGLQCGPPPAPLNAKMVLGGSDQISDDPNQLHGAAASVTYVCDP
GFELIGNPTISCGSDGRWQGDMPICATNVALRKSANQSSTARGGSALNAIDGDRSTFHDV
GGTGGRCAETAKEVSPWWMGDLMRPTAVNAVRVTTRTCCDYKLHDLEIRVGNNTNAQRNP
LCAWFPGSVGDAETKLFQCAKVLIGQFVFVQMVGVESSLSLCEVEVFSAGADIPRESCTD
SAALDKVVAFNRTCYDLQLNEGNTFAKARDTCIKQRGDLWNNVARSTLELITRELERKKH
AMKGVPQLLTAEHTAKTFNTKSNRVSSDELSPMVWVGAQKEASFTSRTWRWVTGNVVERP
PWGREQPNNYNGEQNCVVLDGGRDWLWNDVGCNLDQIHWICKFPPLTCGHPDRRVNSTVV
GKSFSMGATVEYRCPTGSVTLGATTRSCQTNGLWSDDSPTCKHVDCGPLKGIKDGELVIV
DGRTTFGASVKYTCAENYTLVGASKRSCATQGNWEPEEPKYGRCPELPPFERGSITVAGL
NANDTATYSCDLGHKLVGTKVLTCRLGGIWSASPPVCQFVDCGPAPEPAHGSVWLVNGTT
TFSSQATYTCGSDYRLQGRTTRLCQEDGNWSSTLPTCKLIECEEPDIPAGSYVTGTDFTI
HREIRYYCEKGHVMSGDSRRKCLRSGTWSDSAPTCTYVDCGALTEIANGQIAYTNGTTHL
GSEVFYNCVQNYRLEGSSPSRTCMEDGKWSGVAPQCREIRCPMPERPDGVVLSISSSDRL
RAVTLLRNTDRGEASSSSTFRIGSNVIYKCERGFRLDGRNTRVCDESGQWTGEVAVCTYV
DCGSPEETAHGTVSLPGNTTYLSSYAQYVCEVNYKLEGFERRMCLENGSWSGSPPNCKEI
TCAAPAAADDSGVLVTVTSSTVGSQAVYSCQEGRRLVGSLTRKCLVSGVDCNQPEEVENG
RVFLVNGSTIFGSVAEYHCLPTFQRSGHFSRKCGADGRWAGLIPLCIEEGKPIPPLHDNG
LDSLSAGRQSSGSGVWIGVGAGIVLVLFVVIALFYCKMKRGSWIWAAPNGKQNDSSGSNK
KPQTITMVPPNIPLPPTPQTQFTNPVGHQPTYSHHQQMHTLPVSLNGNSIYSSTNDIYEQ
LPGENHHMYDLTYEDTASTRKNRAIQPIPVSNGSPPPSPLPGVTVNGVTVNGFVMA
Download sequence
Identical sequences jgi|Dappu1|238364|SNAP_00006422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]