SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|239483|SNAP_00007541 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|239483|SNAP_00007541
Domain Number 1 Region: 68-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000914
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|239483|SNAP_00007541
Sequence length 129
Sequence
MSRSLLAWIAGILLIAVLSEPVKATCDSNRLRQGCRIQEGSCLCGTGCDTDYRYSNKREC
ESALRGRSQDPCSSRPCNRGSCLQILNAPTGYNCLCSGTNYFGDRCEQRCPRRSSLRAGE
RLPIQCIVV
Download sequence
Identical sequences E9G9G5
jgi|Dappu1|239483|SNAP_00007541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]