SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|239560|SNAP_00007618 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|239560|SNAP_00007618
Domain Number 1 Region: 161-311
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000000353
Family Complement components 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|239560|SNAP_00007618
Sequence length 564
Sequence
MHPFTFIIGVRPLASIPLEAGDTPFRYIEFSTSWGFRGFFRVWVADGAIDQKTRTLCVPK
PVPGLVSEEQAEITVKVGIASSLDDMWSATGSTDTSTLVTVLERFHHNQYAKKPAGKEDT
SQPTDPSTMPTDPSTMPTGPLISGIPTNGADIAMCSITLQRYSDPDLLKSALTWMHGQQN
DDGRFADGPNVTQSQRIETTAFILTCLSDVQHDDIVLFQVNSAAQRFLERELAASREIKT
IAPIATAVLVSHSSVWPETLAKLDSVYDELIDCYLNDRKQCLNEMTYALLAYSHQNKPGK
VLEMVRILVSAPWHILHPLDQLRMMKAWSKYSQVLNDPVRNLNMRLTFQNGEVTLIQSHH
LSNESALGNASTPPQMDYDEENVIAGTSDNETRSESQEEQQNVRMHTPALTYDIPSLPQN
VEVTLSGTGCAFFQCTGKQWSHLLLMDRYSPCTPQSKVPDWMIVSYADDDDDDDDCISCF
AIIIDTHLHVSMKTPCGQFINPENTNLVHRFQFHRFQIGQSAYSVLKRLYTDWPLLDTNE
ISRRWKPVSFETSLSNQENRPAAS
Download sequence
Identical sequences E9G9L8
jgi|Dappu1|239560|SNAP_00007618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]