SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|240630|SNAP_00008688 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|240630|SNAP_00008688
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000175
Family C-type lectin domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|240630|SNAP_00008688
Sequence length 106
Sequence
MSFLELSNDYYWIAARYQESNNRWEWATVEPFQPNDYSNWFLGEPSNNAPGSFVYMNYIF
DNGVWFDEVSTPRLIRMRINGRSVSHNIFYRWQWPRVARNLQSNQT
Download sequence
Identical sequences E9GC01
jgi|Dappu1|240630|SNAP_00008688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]