SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|241302|SNAP_00009360 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|241302|SNAP_00009360
Domain Number 1 Region: 141-219
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000471
Family Pan module (APPLE domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|241302|SNAP_00009360
Sequence length 245
Sequence
MTSDVERSKDAPTPKVFEPSGDVSVSSTPDDVISPPSDDVAVTESIIQTESVDAQQLASP
VDVIKADDVITESVPTADQPAAIPSFIADVKSTAALDEIIITPSVNQSDDGVVPVNSTIT
ETTRAADQIGNCVVNLAIPNRNIPSVTYSTNCDFCNHDMYALTCIPNAFACASLCAGDRR
CSHFTYVANLLGGTCRLKSAPGSGGSWASPIQAPSPYVCGYIGRRAFQNVLLGLCLALDI
NVNIE
Download sequence
Identical sequences E9GDX6
jgi|Dappu1|241302|SNAP_00009360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]