SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|241393|SNAP_00009451 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|241393|SNAP_00009451
Domain Number - Region: 75-130
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000902
Family Pan module (APPLE domain) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|241393|SNAP_00009451
Sequence length 178
Sequence
MQNYFFVLILLAVASAHTLLMDEEPMDFSRERRQVPSFDQEPEVLVEPSADTSVVDPDAK
QALPSTFQPHSEDCVYTNNRQFLGLVLYVRINVASALVCGNTVCSSDPRCTHFTYNPNVN
GGTCTLCSQPGSGGTWSVPTPPSSHIVCGHIPRRSCNPNALISICLGLDLGLGLLGKK
Download sequence
Identical sequences E9GE61
jgi|Dappu1|241393|SNAP_00009451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]