SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|241465|SNAP_00009523 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|241465|SNAP_00009523
Domain Number - Region: 74-129
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000589
Family Pan module (APPLE domain) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|241465|SNAP_00009523
Sequence length 154
Sequence
MQNYFFVLILLAVASAHTLLMDEEPMDFSRERRQVPSFDEEPEVIEPSADSTSVVDPATK
LTLLTPQPYSEDCVYTYNRQFLGLVLYVQINVGSALVCGNEICSSDSRCTHFTYNALLNG
GTCTLYSQPLSGGAWSVPTPPSSRIICGHIPRRS
Download sequence
Identical sequences E9GEB3
jgi|Dappu1|241465|SNAP_00009523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]