SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|242011|SNAP_00010069 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|242011|SNAP_00010069
Domain Number 1 Region: 76-118
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000167
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|242011|SNAP_00010069
Sequence length 328
Sequence
MKTKFVNVYAASSSKLEVRGCSLPPEIANGRYQILPMRRSFSSSSFSPLSSRIQHWNNLQ
MSSNGSSTPTTSPVVVVPIYSSALYSCYRGFLSGGSSLISCSPGGWWQPTHNAPRCLPFG
SSSSASSGGIHHSHGTYPTAAAAPSSSSSSDFGGGGGLEMTKAGRGGDADGGEGDDKVDG
EEQAPGTLLVSFTTACGVTFVLCLIWMASRWKITCLRSSAGQHGRQEEETLSFSGPVCPP
MAPSAASASSSSSGGVGGRRHRHQSLWTWISPNQNDRGGHHVHQQLDMDDDDSLPAYDRQ
LLDLGQASDQDRVALIAYMNDNNTSSQT
Download sequence
Identical sequences E9GFM0
jgi|Dappu1|242011|SNAP_00010069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]