SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|242508|SNAP_00010566 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|242508|SNAP_00010566
Domain Number - Region: 110-139
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0602
Family Antifungal peptide scarabaecin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|242508|SNAP_00010566
Sequence length 241
Sequence
MYPGSNLVTTCASWRKGSRIRRQLMLRSAENGRTIPSLDDMVNENSTKSIVLVNDAPSGK
DSRVADIDYFRMLGFVSLFSKSLCLAKLSIPPFPMSNVVENVLVAPQGQIPRCCNVAVRC
AEGNHEDSKCPSNDLWNKVKTLLTEHSIQKKECQTSLQEVMETSQWQVSLIHGFLEVLAS
EKKAEDHSTTNHYWTNLSTLRAACQFLQIPYSGQRGQEKREDFDIGENGVMMDTGHIGQI
I
Download sequence
Identical sequences E9GGU3
jgi|Dappu1|242508|SNAP_00010566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]