SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|243666|SNAP_00011724 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|243666|SNAP_00011724
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-20
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 2 Region: 197-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000228
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|243666|SNAP_00011724
Domain Number - Region: 318-366
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0032
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|243666|SNAP_00011724
Sequence length 449
Sequence
MDCYCLVSKKMIREDARQHCRDNNMHLLSIETQEENEFVINLVKKNDDLIPNQFWTLGYN
ANLDPNNWGWQQPNLNVSKPLTYKNWCRGSEPDNGFENEHFIAVINRCWHDVPGHFDWAS
VCEREANIFDPNLDEKFFFTFPGEHKAVVPCRPATNFDLFRVKVSKEIKKPTSVFHQIIL
NGTSGNKNYEYDPLEGFVIKNVSVSDNGTYKCSIFLGMQEAWQHFHVITTVLKANPRWDP
SEGTDVTLTCNTQKLKLRDRTVDPVEWSVVFADSKDETVLTQTNAAALPIENVVWSDKIS
RKELKGILTPASTNAENYRVIPVGSDLRISCSFGTSGHLRYYQWQWEQFDDNPQYTSEII
SNGTTSDDNYEYNPQKGFIIHRLLPEHDELRSSTSFQCKAASGKIEAGPEKFSIMERLLN
VRKGAGVHHLNESMDYSTPELTQLSYNKE
Download sequence
Identical sequences E9GJC4
jgi|Dappu1|243666|SNAP_00011724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]